BLASTX nr result
ID: Atractylodes21_contig00029893
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00029893 (218 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF62469.1| hypothetical protein [Nicotiana tabacum] 55 6e-06 >dbj|BAF62469.1| hypothetical protein [Nicotiana tabacum] Length = 463 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/48 (58%), Positives = 34/48 (70%) Frame = +2 Query: 74 MPPFSQSGPLSIGFSHNHHRFDNPNHHSSTNVVTIDVGGQLFQTTKQT 217 MPPF+ S PLS FS N + S++N++TIDVGGQLFQTTKQT Sbjct: 1 MPPFAGSNPLSYNFSRN-------SIDSASNIITIDVGGQLFQTTKQT 41