BLASTX nr result
ID: Atractylodes21_contig00029803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00029803 (354 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270810.2| PREDICTED: uncharacterized protein LOC100244... 55 8e-06 >ref|XP_002270810.2| PREDICTED: uncharacterized protein LOC100244219 [Vitis vinifera] gi|297737287|emb|CBI26488.3| unnamed protein product [Vitis vinifera] Length = 439 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = +2 Query: 2 VNLVQSIPHKNILPFEPRVGDLRNRYKNFLASKFGKLPQEFSF 130 V LVQS KN+ PFEP+ GDL +YK+FL+ KF +LP+EF F Sbjct: 397 VKLVQSTLTKNVPPFEPKGGDLEGKYKSFLSGKFKELPEEFLF 439