BLASTX nr result
ID: Atractylodes21_contig00029778
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00029778 (215 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315216.1| predicted protein [Populus trichocarpa] gi|2... 50 3e-10 emb|CAN72193.1| hypothetical protein VITISV_022309 [Vitis vinifera] 51 2e-09 ref|XP_002283232.2| PREDICTED: E3 ubiquitin-protein ligase SDIR1... 51 2e-09 ref|NP_001242131.1| uncharacterized protein LOC100816448 [Glycin... 50 3e-09 ref|XP_002531577.1| protein binding protein, putative [Ricinus c... 48 7e-09 >ref|XP_002315216.1| predicted protein [Populus trichocarpa] gi|222864256|gb|EEF01387.1| predicted protein [Populus trichocarpa] Length = 276 Score = 50.4 bits (119), Expect(2) = 3e-10 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 97 QFHADCIYRIDPWLRVRQQGTCPVCKFRVGS 5 QFHA+CI DPWLR QQGTCPVCKFR GS Sbjct: 235 QFHANCI---DPWLR--QQGTCPVCKFRAGS 260 Score = 38.9 bits (89), Expect(2) = 3e-10 Identities = 18/27 (66%), Positives = 23/27 (85%), Gaps = 2/27 (7%) Frame = -3 Query: 213 KVDTGS--GNLKSSEDELTCSICLETV 139 K DTG+ G++KSS+DELTCS+CLE V Sbjct: 195 KQDTGNAIGSMKSSDDELTCSVCLEQV 221 >emb|CAN72193.1| hypothetical protein VITISV_022309 [Vitis vinifera] Length = 1218 Score = 50.8 bits (120), Expect(2) = 2e-09 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -2 Query: 97 QFHADCIYRIDPWLRVRQQGTCPVCKFRVGS 5 QFHA+CI DPWLR QQGTCPVCKFRVG+ Sbjct: 893 QFHANCI---DPWLR--QQGTCPVCKFRVGA 918 Score = 35.8 bits (81), Expect(2) = 2e-09 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -3 Query: 201 GSGNLKSSEDELTCSICLETV 139 G ++K SEDELTCSICLE V Sbjct: 859 GDSSMKGSEDELTCSICLEQV 879 >ref|XP_002283232.2| PREDICTED: E3 ubiquitin-protein ligase SDIR1 [Vitis vinifera] gi|297746043|emb|CBI16099.3| unnamed protein product [Vitis vinifera] Length = 279 Score = 50.8 bits (120), Expect(2) = 2e-09 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -2 Query: 97 QFHADCIYRIDPWLRVRQQGTCPVCKFRVGS 5 QFHA+CI DPWLR QQGTCPVCKFRVG+ Sbjct: 238 QFHANCI---DPWLR--QQGTCPVCKFRVGA 263 Score = 35.8 bits (81), Expect(2) = 2e-09 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -3 Query: 201 GSGNLKSSEDELTCSICLETV 139 G ++K SEDELTCSICLE V Sbjct: 204 GDSSMKGSEDELTCSICLEQV 224 >ref|NP_001242131.1| uncharacterized protein LOC100816448 [Glycine max] gi|255641194|gb|ACU20874.1| unknown [Glycine max] Length = 274 Score = 50.4 bits (119), Expect(2) = 3e-09 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 97 QFHADCIYRIDPWLRVRQQGTCPVCKFRVGS 5 QFHA+CI DPWLR QQGTCPVCKFR GS Sbjct: 234 QFHANCI---DPWLR--QQGTCPVCKFRAGS 259 Score = 35.8 bits (81), Expect(2) = 3e-09 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -3 Query: 204 TGSGNLKSSEDELTCSICLETV 139 T G++K+S+DELTCS+CLE V Sbjct: 199 TAVGSMKASDDELTCSVCLEQV 220 >ref|XP_002531577.1| protein binding protein, putative [Ricinus communis] gi|223528807|gb|EEF30813.1| protein binding protein, putative [Ricinus communis] Length = 276 Score = 48.1 bits (113), Expect(2) = 7e-09 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -2 Query: 97 QFHADCIYRIDPWLRVRQQGTCPVCKFRVGS 5 QFHA+CI DPWLR QQGTCPVCKFR S Sbjct: 235 QFHANCI---DPWLR--QQGTCPVCKFRAAS 260 Score = 36.6 bits (83), Expect(2) = 7e-09 Identities = 17/27 (62%), Positives = 22/27 (81%), Gaps = 2/27 (7%) Frame = -3 Query: 213 KVDTGS--GNLKSSEDELTCSICLETV 139 K DT + G++K+SEDELTCS+CLE V Sbjct: 195 KQDTANAVGSMKASEDELTCSVCLEQV 221