BLASTX nr result
ID: Atractylodes21_contig00029609
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00029609 (327 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509636.1| leucine-rich repeat-containing protein, puta... 64 2e-08 ref|XP_002307567.1| predicted protein [Populus trichocarpa] gi|2... 63 3e-08 ref|XP_003530669.1| PREDICTED: TMV resistance protein N-like [Gl... 62 5e-08 ref|XP_002277500.2| PREDICTED: TMV resistance protein N-like [Vi... 62 6e-08 emb|CBI40966.3| unnamed protein product [Vitis vinifera] 62 6e-08 >ref|XP_002509636.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223549535|gb|EEF51023.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Length = 1137 Score = 63.5 bits (153), Expect = 2e-08 Identities = 32/70 (45%), Positives = 43/70 (61%) Frame = -3 Query: 325 RLECLEKLLLSHCTFLRDIPNSICKMKSLRHFSLSGCILVKKLPEELGCSKSLRALVIGG 146 R + L L +++CT L +P+SICK+KSL SL GC ++ PE L L+ LV+ G Sbjct: 671 RWKSLSTLEMNYCTKLESLPSSICKLKSLESLSLCGCSNLQSFPEILESMDRLKVLVLNG 730 Query: 145 TAISHLPQSI 116 TAI LP SI Sbjct: 731 TAIKELPSSI 740 >ref|XP_002307567.1| predicted protein [Populus trichocarpa] gi|222857016|gb|EEE94563.1| predicted protein [Populus trichocarpa] Length = 580 Score = 62.8 bits (151), Expect = 3e-08 Identities = 40/111 (36%), Positives = 59/111 (53%), Gaps = 16/111 (14%) Frame = -3 Query: 313 LEKLLL---SHCTFLRDIPNSICKMKSLRHFSLSGCILVKKLPEELGCSKSLRALVIGGT 143 L +LLL +C L+ +P SIC + SL+ ++SGC+ ++ LPE+LG KSL L+ GT Sbjct: 114 LGRLLLLNFKNCKSLKTLPGSICALSSLKKLNVSGCLKLEGLPEDLGSLKSLVVLLADGT 173 Query: 142 AISHLPQSI---------FLSDSRIIFGSRSLLQSY----ASTHEIHTTQC 29 AIS +P++I D +IF R Q+ AS E+ C Sbjct: 174 AISTIPETIGNLEKLKILSFHDCHLIFSPRKFPQTMNIFPASLQELDLRHC 224 >ref|XP_003530669.1| PREDICTED: TMV resistance protein N-like [Glycine max] Length = 1447 Score = 62.0 bits (149), Expect = 5e-08 Identities = 32/70 (45%), Positives = 43/70 (61%) Frame = -3 Query: 322 LECLEKLLLSHCTFLRDIPNSICKMKSLRHFSLSGCILVKKLPEELGCSKSLRALVIGGT 143 L L L L+ C+ L ++P + +K L LSGC +K LPE +G KSL+AL GT Sbjct: 715 LSTLRSLKLTRCSSLINLPIDVSGLKQLESLFLSGCTKLKSLPENIGILKSLKALHADGT 774 Query: 142 AISHLPQSIF 113 AI+ LP+SIF Sbjct: 775 AITELPRSIF 784 >ref|XP_002277500.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Length = 1132 Score = 61.6 bits (148), Expect = 6e-08 Identities = 33/66 (50%), Positives = 39/66 (59%) Frame = -3 Query: 313 LEKLLLSHCTFLRDIPNSICKMKSLRHFSLSGCILVKKLPEELGCSKSLRALVIGGTAIS 134 L L L C L++IPNSICK+KSL F SGC V+ PE G + L+ L TAIS Sbjct: 653 LSFLSLRDCKMLKNIPNSICKLKSLETFIFSGCSKVENFPENFGNLEQLKELYADETAIS 712 Query: 133 HLPQSI 116 LP SI Sbjct: 713 ALPSSI 718 >emb|CBI40966.3| unnamed protein product [Vitis vinifera] Length = 1201 Score = 61.6 bits (148), Expect = 6e-08 Identities = 33/66 (50%), Positives = 39/66 (59%) Frame = -3 Query: 313 LEKLLLSHCTFLRDIPNSICKMKSLRHFSLSGCILVKKLPEELGCSKSLRALVIGGTAIS 134 L L L C L++IPNSICK+KSL F SGC V+ PE G + L+ L TAIS Sbjct: 679 LSFLSLRDCKMLKNIPNSICKLKSLETFIFSGCSKVENFPENFGNLEQLKELYADETAIS 738 Query: 133 HLPQSI 116 LP SI Sbjct: 739 ALPSSI 744