BLASTX nr result
ID: Atractylodes21_contig00029608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00029608 (410 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307567.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 ref|XP_002509636.1| leucine-rich repeat-containing protein, puta... 60 2e-07 gb|ABF81465.1| TIR-NBS-LRR type disease resistance protein [Popu... 60 2e-07 ref|XP_002277500.2| PREDICTED: TMV resistance protein N-like [Vi... 60 2e-07 emb|CBI40966.3| unnamed protein product [Vitis vinifera] 60 2e-07 >ref|XP_002307567.1| predicted protein [Populus trichocarpa] gi|222857016|gb|EEE94563.1| predicted protein [Populus trichocarpa] Length = 580 Score = 61.6 bits (148), Expect = 6e-08 Identities = 32/69 (46%), Positives = 48/69 (69%), Gaps = 3/69 (4%) Frame = -3 Query: 396 LEKLLLVH---CTFLRDIPNSICKMKRLRYFSLSGCILVKKLPEELGRSKSLRVLLIGGT 226 L +LLL++ C L+ +P SIC + L+ ++SGC+ ++ LPE+LG KSL VLL GT Sbjct: 114 LGRLLLLNFKNCKSLKTLPGSICALSSLKKLNVSGCLKLEGLPEDLGSLKSLVVLLADGT 173 Query: 225 AISHLPQSI 199 AIS +P++I Sbjct: 174 AISTIPETI 182 >ref|XP_002509636.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223549535|gb|EEF51023.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Length = 1137 Score = 60.1 bits (144), Expect = 2e-07 Identities = 31/70 (44%), Positives = 42/70 (60%) Frame = -3 Query: 408 RLECLEKLLLVHCTFLRDIPNSICKMKRLRYFSLSGCILVKKLPEELGRSKSLRVLLIGG 229 R + L L + +CT L +P+SICK+K L SL GC ++ PE L L+VL++ G Sbjct: 671 RWKSLSTLEMNYCTKLESLPSSICKLKSLESLSLCGCSNLQSFPEILESMDRLKVLVLNG 730 Query: 228 TAISHLPQSI 199 TAI LP SI Sbjct: 731 TAIKELPSSI 740 >gb|ABF81465.1| TIR-NBS-LRR type disease resistance protein [Populus trichocarpa] Length = 1139 Score = 60.1 bits (144), Expect = 2e-07 Identities = 31/69 (44%), Positives = 45/69 (65%) Frame = -3 Query: 405 LECLEKLLLVHCTFLRDIPNSICKMKRLRYFSLSGCILVKKLPEELGRSKSLRVLLIGGT 226 L+ L L L C L+++P SIC +K L ++S CI ++KLP++LG ++L +LL GT Sbjct: 756 LDSLTLLNLEGCKSLKNLPESICYLKCLESLNISRCINLEKLPDQLGDMEALTMLLADGT 815 Query: 225 AISHLPQSI 199 AI LP SI Sbjct: 816 AIERLPSSI 824 >ref|XP_002277500.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Length = 1132 Score = 59.7 bits (143), Expect = 2e-07 Identities = 32/66 (48%), Positives = 38/66 (57%) Frame = -3 Query: 396 LEKLLLVHCTFLRDIPNSICKMKRLRYFSLSGCILVKKLPEELGRSKSLRVLLIGGTAIS 217 L L L C L++IPNSICK+K L F SGC V+ PE G + L+ L TAIS Sbjct: 653 LSFLSLRDCKMLKNIPNSICKLKSLETFIFSGCSKVENFPENFGNLEQLKELYADETAIS 712 Query: 216 HLPQSI 199 LP SI Sbjct: 713 ALPSSI 718 >emb|CBI40966.3| unnamed protein product [Vitis vinifera] Length = 1201 Score = 59.7 bits (143), Expect = 2e-07 Identities = 32/66 (48%), Positives = 38/66 (57%) Frame = -3 Query: 396 LEKLLLVHCTFLRDIPNSICKMKRLRYFSLSGCILVKKLPEELGRSKSLRVLLIGGTAIS 217 L L L C L++IPNSICK+K L F SGC V+ PE G + L+ L TAIS Sbjct: 679 LSFLSLRDCKMLKNIPNSICKLKSLETFIFSGCSKVENFPENFGNLEQLKELYADETAIS 738 Query: 216 HLPQSI 199 LP SI Sbjct: 739 ALPSSI 744