BLASTX nr result
ID: Atractylodes21_contig00029595
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00029595 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAK03840.1| predicted protein [Hordeum vulgare subsp. vulgare] 80 2e-13 ref|XP_002442486.1| hypothetical protein SORBIDRAFT_08g020810 [S... 79 4e-13 gb|AAA67356.1| 3-methylcrotonyl-CoA carboxylase precursor [Arabi... 79 5e-13 ref|NP_563674.1| methylcrotonoyl-CoA carboxylase subunit alpha [... 79 5e-13 gb|AAD25800.1|AC006550_8 Identical to gb|U12536 3-methylcrotonyl... 79 5e-13 >dbj|BAK03840.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 550 Score = 79.7 bits (195), Expect = 2e-13 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -3 Query: 122 AIHPGYGFLSENADFAQLCENEGLTFVGPPASAIREMGDK 3 AIHPGYGFLSE+ADFAQLCE+EGLTF+GPP SAIR+MGDK Sbjct: 118 AIHPGYGFLSESADFAQLCESEGLTFIGPPPSAIRDMGDK 157 >ref|XP_002442486.1| hypothetical protein SORBIDRAFT_08g020810 [Sorghum bicolor] gi|241943179|gb|EES16324.1| hypothetical protein SORBIDRAFT_08g020810 [Sorghum bicolor] Length = 752 Score = 79.0 bits (193), Expect = 4e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -3 Query: 122 AIHPGYGFLSENADFAQLCENEGLTFVGPPASAIREMGDK 3 AIHPGYGFLSE+ADFAQLCE EGL F+GPPASAIR+MGDK Sbjct: 130 AIHPGYGFLSESADFAQLCETEGLKFIGPPASAIRDMGDK 169 >gb|AAA67356.1| 3-methylcrotonyl-CoA carboxylase precursor [Arabidopsis thaliana] Length = 715 Score = 78.6 bits (192), Expect = 5e-13 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -3 Query: 122 AIHPGYGFLSENADFAQLCENEGLTFVGPPASAIREMGDK 3 AIHPGYGFLSE++DFAQLCE+ GLTF+GPPASAIR+MGDK Sbjct: 114 AIHPGYGFLSESSDFAQLCEDSGLTFIGPPASAIRDMGDK 153 >ref|NP_563674.1| methylcrotonoyl-CoA carboxylase subunit alpha [Arabidopsis thaliana] gi|332189407|gb|AEE27528.1| methylcrotonoyl-CoA carboxylase subunit alpha [Arabidopsis thaliana] Length = 714 Score = 78.6 bits (192), Expect = 5e-13 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -3 Query: 122 AIHPGYGFLSENADFAQLCENEGLTFVGPPASAIREMGDK 3 AIHPGYGFLSE++DFAQLCE+ GLTF+GPPASAIR+MGDK Sbjct: 113 AIHPGYGFLSESSDFAQLCEDSGLTFIGPPASAIRDMGDK 152 >gb|AAD25800.1|AC006550_8 Identical to gb|U12536 3-methylcrotonyl-CoA carboxylase precursor protein from Arabidopsis thaliana. ESTs gb|H35836, gb|AA651295 and gb|AA721862 come from this gene [Arabidopsis thaliana] Length = 730 Score = 78.6 bits (192), Expect = 5e-13 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -3 Query: 122 AIHPGYGFLSENADFAQLCENEGLTFVGPPASAIREMGDK 3 AIHPGYGFLSE++DFAQLCE+ GLTF+GPPASAIR+MGDK Sbjct: 113 AIHPGYGFLSESSDFAQLCEDSGLTFIGPPASAIRDMGDK 152