BLASTX nr result
ID: Atractylodes21_contig00029568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00029568 (353 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275546.2| PREDICTED: pentatricopeptide repeat-containi... 69 4e-10 emb|CBI27235.3| unnamed protein product [Vitis vinifera] 69 4e-10 ref|XP_002532711.1| pentatricopeptide repeat-containing protein,... 55 8e-06 >ref|XP_002275546.2| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Vitis vinifera] Length = 896 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/54 (59%), Positives = 40/54 (74%) Frame = -1 Query: 164 SPKTPSSIQKPTSDSRSYSSWIEQLRSHTRSGNFHDAISSYIDMTTGGHRPDNF 3 SP T + KPTS SRS +SW++ LRS TRS +F +AIS+YI+MT G RPDNF Sbjct: 40 SPLTSKTPPKPTSPSRSTASWVDALRSRTRSNDFREAISTYIEMTVSGARPDNF 93 >emb|CBI27235.3| unnamed protein product [Vitis vinifera] Length = 696 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/54 (59%), Positives = 40/54 (74%) Frame = -1 Query: 164 SPKTPSSIQKPTSDSRSYSSWIEQLRSHTRSGNFHDAISSYIDMTTGGHRPDNF 3 SP T + KPTS SRS +SW++ LRS TRS +F +AIS+YI+MT G RPDNF Sbjct: 40 SPLTSKTPPKPTSPSRSTASWVDALRSRTRSNDFREAISTYIEMTVSGARPDNF 93 >ref|XP_002532711.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527557|gb|EEF29678.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 679 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = -1 Query: 137 KPTSDSRSYSSWIEQLRSHTRSGNFHDAISSYIDMTTGGHRPDNF 3 KP S SRS +SWIE LR +TRS F +AIS+Y+DM G PD++ Sbjct: 34 KPISQSRSQASWIESLRFNTRSNLFREAISTYVDMILSGVSPDSY 78