BLASTX nr result
ID: Atractylodes21_contig00028941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00028941 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278486.2| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 >ref|XP_002278486.2| PREDICTED: pentatricopeptide repeat-containing protein At3g21470 [Vitis vinifera] Length = 575 Score = 58.5 bits (140), Expect = 5e-07 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 3/86 (3%) Frame = +3 Query: 51 KTRSELKNYLQTDTQL---IRKASDFCHRINQPNLSSNLYSSIRIHLSNGAPKEALLIYA 221 K ++E +N+ L +++ SDFC P+LS N IR +LS GAP+EALL+Y Sbjct: 26 KPQNERQNHQTQSPSLPKSLKQGSDFCPGKGTPSLS-NWCHLIRSYLSQGAPREALLVYT 84 Query: 222 QNRRNLLCMLRVVPLVFKARASLSMI 299 RR + +L V PLV KA ASLS++ Sbjct: 85 GLRRKGVYLLGVAPLVLKACASLSIV 110