BLASTX nr result
ID: Atractylodes21_contig00028638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00028638 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_199010.1| tetratricopeptide repeat domain-containing prot... 69 4e-10 ref|XP_002870606.1| binding protein [Arabidopsis lyrata subsp. l... 69 4e-10 ref|XP_003536173.1| PREDICTED: uncharacterized protein LOC100809... 67 1e-09 ref|XP_003536172.1| PREDICTED: uncharacterized protein LOC100809... 67 1e-09 ref|XP_002466936.1| hypothetical protein SORBIDRAFT_01g017010 [S... 67 1e-09 >ref|NP_199010.1| tetratricopeptide repeat domain-containing protein [Arabidopsis thaliana] gi|9757940|dbj|BAB08428.1| unnamed protein product [Arabidopsis thaliana] gi|21553690|gb|AAM62783.1| unknown [Arabidopsis thaliana] gi|22135938|gb|AAM91551.1| putative protein [Arabidopsis thaliana] gi|133778836|gb|ABO38758.1| At5g41950 [Arabidopsis thaliana] gi|332007363|gb|AED94746.1| tetratricopeptide repeat domain-containing protein [Arabidopsis thaliana] Length = 565 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 121 IADSWEYLDMWLDAIRLVYTIYARGKTDVLAGIITG 14 +ADSWE LD WLDAIRLVYTIYARGK+DVLAGIITG Sbjct: 530 VADSWESLDGWLDAIRLVYTIYARGKSDVLAGIITG 565 >ref|XP_002870606.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297316442|gb|EFH46865.1| binding protein [Arabidopsis lyrata subsp. lyrata] Length = 550 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 121 IADSWEYLDMWLDAIRLVYTIYARGKTDVLAGIITG 14 +ADSWE LD WLDAIRLVYTIYARGK+DVLAGIITG Sbjct: 515 VADSWESLDGWLDAIRLVYTIYARGKSDVLAGIITG 550 >ref|XP_003536173.1| PREDICTED: uncharacterized protein LOC100809275 isoform 2 [Glycine max] Length = 540 Score = 67.4 bits (163), Expect = 1e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -3 Query: 121 IADSWEYLDMWLDAIRLVYTIYARGKTDVLAGIITG 14 +ADSWE LD WLDAIRLVYTIY RGK+DVLAGIITG Sbjct: 505 VADSWESLDGWLDAIRLVYTIYVRGKSDVLAGIITG 540 >ref|XP_003536172.1| PREDICTED: uncharacterized protein LOC100809275 isoform 1 [Glycine max] Length = 534 Score = 67.4 bits (163), Expect = 1e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -3 Query: 121 IADSWEYLDMWLDAIRLVYTIYARGKTDVLAGIITG 14 +ADSWE LD WLDAIRLVYTIY RGK+DVLAGIITG Sbjct: 499 VADSWESLDGWLDAIRLVYTIYVRGKSDVLAGIITG 534 >ref|XP_002466936.1| hypothetical protein SORBIDRAFT_01g017010 [Sorghum bicolor] gi|241920790|gb|EER93934.1| hypothetical protein SORBIDRAFT_01g017010 [Sorghum bicolor] Length = 487 Score = 67.4 bits (163), Expect = 1e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 121 IADSWEYLDMWLDAIRLVYTIYARGKTDVLAGIITG 14 +ADSWE LD WLDAIRLVYTI+ARGK+DVLAGIITG Sbjct: 452 VADSWEALDGWLDAIRLVYTIFARGKSDVLAGIITG 487