BLASTX nr result
ID: Atractylodes21_contig00028547
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00028547 (264 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531595.1| pentatricopeptide repeat-containing protein,... 72 4e-11 ref|XP_002517927.1| pentatricopeptide repeat-containing protein,... 69 3e-10 emb|CBI21840.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_002273904.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 emb|CAN73453.1| hypothetical protein VITISV_024964 [Vitis vinifera] 64 1e-08 >ref|XP_002531595.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528791|gb|EEF30798.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 176 Score = 72.4 bits (176), Expect = 4e-11 Identities = 32/75 (42%), Positives = 49/75 (65%) Frame = +3 Query: 6 YVGRVVDMGKQPPASTWVLFATAYTRKNEMDKAVEMLRKCVNIEDKRGCKLDQDTFRACV 185 +V R + G++P A TW AT Y + N+ +KAVEM++K + + + K ++ +C+ Sbjct: 57 FVNRAISEGRKPDAITWYYLATGYLQNNQTEKAVEMMKKALEVSGSK-LKSSSESLASCL 115 Query: 186 EYLKGKGDLEGAEEI 230 EYLKGKGDLE AEE+ Sbjct: 116 EYLKGKGDLEKAEEL 130 >ref|XP_002517927.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542909|gb|EEF44445.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 507 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/72 (44%), Positives = 50/72 (69%) Frame = +3 Query: 30 GKQPPASTWVLFATAYTRKNEMDKAVEMLRKCVNIEDKRGCKLDQDTFRACVEYLKGKGD 209 G+ P ASTW+ A +Y +N+M KAVEML+K +++ ++G K + T C++YL+ +GD Sbjct: 389 GRTPYASTWITMAMSYIGQNQMSKAVEMLKKAISV-SRKGWKPNPITLTTCLDYLEEQGD 447 Query: 210 LEGAEEIERSFK 245 +EG EEI +S K Sbjct: 448 VEGIEEIVKSLK 459 >emb|CBI21840.3| unnamed protein product [Vitis vinifera] Length = 446 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/76 (43%), Positives = 48/76 (63%) Frame = +3 Query: 9 VGRVVDMGKQPPASTWVLFATAYTRKNEMDKAVEMLRKCVNIEDKRGCKLDQDTFRACVE 188 V R ++ G++P A TW A Y N+M+KAV+ L+K + + +G K + T AC+E Sbjct: 316 VSRAIEQGEEPIAVTWDALAAGYHENNQMEKAVDTLKKAL-LATSQGWKPNPVTLSACLE 374 Query: 189 YLKGKGDLEGAEEIER 236 YLKGKGD+E AE + R Sbjct: 375 YLKGKGDVEEAENLIR 390 >ref|XP_002273904.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial [Vitis vinifera] Length = 499 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/76 (43%), Positives = 48/76 (63%) Frame = +3 Query: 9 VGRVVDMGKQPPASTWVLFATAYTRKNEMDKAVEMLRKCVNIEDKRGCKLDQDTFRACVE 188 V R ++ G++P A TW A Y N+M+KAV+ L+K + + +G K + T AC+E Sbjct: 369 VSRAIEQGEEPIAVTWDALAAGYHENNQMEKAVDTLKKAL-LATSQGWKPNPVTLSACLE 427 Query: 189 YLKGKGDLEGAEEIER 236 YLKGKGD+E AE + R Sbjct: 428 YLKGKGDVEEAENLIR 443 >emb|CAN73453.1| hypothetical protein VITISV_024964 [Vitis vinifera] Length = 499 Score = 64.3 bits (155), Expect = 1e-08 Identities = 32/76 (42%), Positives = 47/76 (61%) Frame = +3 Query: 9 VGRVVDMGKQPPASTWVLFATAYTRKNEMDKAVEMLRKCVNIEDKRGCKLDQDTFRACVE 188 V R ++ G++P A TW A Y N+M+KAV+ L+K + + +G K + T AC+E Sbjct: 369 VSRAIEQGEEPIAVTWDALAAGYHENNQMEKAVDTLKKAL-LATSQGWKPNPVTLSACLE 427 Query: 189 YLKGKGDLEGAEEIER 236 YLKGK D+E AE + R Sbjct: 428 YLKGKXDVEEAENLIR 443