BLASTX nr result
ID: Atractylodes21_contig00028489
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00028489 (326 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADZ24000.1| allene oxide synthase [Artemisia annua] 82 3e-14 sp|Q40778.2|C74A2_PARAR RecName: Full=Allene oxide synthase; Alt... 74 1e-11 gb|AAY27751.1| allene oxide synthase [Hevea brasiliensis] 72 4e-11 ref|XP_002302453.1| cytochrome P450 allene oxide synthase [Popul... 70 1e-10 gb|ADN92996.2| allene oxide synthase AOS [Ipomoea nil] 70 2e-10 >gb|ADZ24000.1| allene oxide synthase [Artemisia annua] Length = 526 Score = 82.4 bits (202), Expect = 3e-14 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = +3 Query: 3 KDFVVLITRLFVIELFRRYDSFDIEVAPSPLGARVTLTSLKRARV 137 KDFVVLITRLFVIELFRRYDSFDIEV SPLGA++TLTSLKRARV Sbjct: 482 KDFVVLITRLFVIELFRRYDSFDIEVGASPLGAKITLTSLKRARV 526 >sp|Q40778.2|C74A2_PARAR RecName: Full=Allene oxide synthase; AltName: Full=Cytochrome P450 74A2; AltName: Full=Rubber particle protein; Short=RPP gi|206582008|pdb|3DAM|A Chain A, Crystal Structure Of Allene Oxide Synthase gi|206582009|pdb|3DAN|A Chain A, Crystal Structure Of Allene Oxide Synthase gi|206582010|pdb|3DBM|A Chain A, Crystal Structure Of Allene Oxide Synthase gi|198446807|emb|CAA55025.2| rubber particle protein [Parthenium argentatum] Length = 473 Score = 73.9 bits (180), Expect = 1e-11 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = +3 Query: 3 KDFVVLITRLFVIELFRRYDSFDIEVAPSPLGARVTLTSLKRARV 137 KDFVVLITRLFVIELFRRYDSF+IE+ SPLGA VTLT LKRA + Sbjct: 429 KDFVVLITRLFVIELFRRYDSFEIELGESPLGAAVTLTFLKRASI 473 >gb|AAY27751.1| allene oxide synthase [Hevea brasiliensis] Length = 524 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = +3 Query: 3 KDFVVLITRLFVIELFRRYDSFDIEVAPSPLGARVTLTSLKRA 131 KDFVVLI+RLFV+ELFRRYDSF+IEV SPLG+ +T+TSLKRA Sbjct: 480 KDFVVLISRLFVVELFRRYDSFEIEVGSSPLGSSITITSLKRA 522 >ref|XP_002302453.1| cytochrome P450 allene oxide synthase [Populus trichocarpa] gi|222844179|gb|EEE81726.1| cytochrome P450 allene oxide synthase [Populus trichocarpa] Length = 526 Score = 70.5 bits (171), Expect = 1e-10 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +3 Query: 3 KDFVVLITRLFVIELFRRYDSFDIEVAPSPLGARVTLTSLKRA 131 KDFVVL++RLFV+ELF RYDSF+IEV SPLGA VT+TSLKRA Sbjct: 482 KDFVVLVSRLFVVELFLRYDSFEIEVGTSPLGAAVTVTSLKRA 524 >gb|ADN92996.2| allene oxide synthase AOS [Ipomoea nil] Length = 376 Score = 69.7 bits (169), Expect = 2e-10 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +3 Query: 3 KDFVVLITRLFVIELFRRYDSFDIEVAPSPLGARVTLTSLKRA 131 KDFVVL++RL V+ELF RYDSFDIEV SPLGA VT+TSLKRA Sbjct: 332 KDFVVLVSRLMVVELFLRYDSFDIEVGTSPLGASVTVTSLKRA 374