BLASTX nr result
ID: Atractylodes21_contig00028468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00028468 (252 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272034.2| PREDICTED: TMV resistance protein N-like [Vi... 58 7e-07 emb|CAN61853.1| hypothetical protein VITISV_027841 [Vitis vinifera] 58 7e-07 ref|XP_002512273.1| leucine-rich repeat-containing protein, puta... 57 1e-06 ref|XP_002519358.1| leucine-rich repeat-containing protein, puta... 57 2e-06 >ref|XP_002272034.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Length = 1233 Score = 58.2 bits (139), Expect = 7e-07 Identities = 33/69 (47%), Positives = 48/69 (69%), Gaps = 1/69 (1%) Frame = +1 Query: 49 WRSALNSLTSQEGGLHSKVQDILQRSFNTLPFDSLKELFLHIACFFVGEYENYVVKILEH 228 W S L+ L + L++KVQD+L+ SF+ L F KE+FL +ACFF G+ ++V+KIL+ Sbjct: 405 WESELHKLKKE---LNTKVQDVLRISFDGLDFTQ-KEIFLDLACFFKGQEYDFVIKILDG 460 Query: 229 -DWHAKSGI 252 +HAKSGI Sbjct: 461 CGFHAKSGI 469 >emb|CAN61853.1| hypothetical protein VITISV_027841 [Vitis vinifera] Length = 1244 Score = 58.2 bits (139), Expect = 7e-07 Identities = 33/69 (47%), Positives = 48/69 (69%), Gaps = 1/69 (1%) Frame = +1 Query: 49 WRSALNSLTSQEGGLHSKVQDILQRSFNTLPFDSLKELFLHIACFFVGEYENYVVKILEH 228 W S L+ L + L++KVQD+L+ SF+ L F KE+FL +ACFF G+ ++V+KIL+ Sbjct: 405 WESELHKLKKE---LNTKVQDVLRISFDGLDFTQ-KEIFLDLACFFKGQEYDFVIKILDG 460 Query: 229 -DWHAKSGI 252 +HAKSGI Sbjct: 461 CGFHAKSGI 469 >ref|XP_002512273.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223548234|gb|EEF49725.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Length = 1166 Score = 57.4 bits (137), Expect = 1e-06 Identities = 32/75 (42%), Positives = 47/75 (62%), Gaps = 1/75 (1%) Frame = +1 Query: 31 NEIIEIWRSALNSLTSQEGGLHSKVQDILQRSFNTLPFDSLKELFLHIACFFVGEYENYV 210 +++ + W S L L + H K+Q LQ S+++L D K LFLHIACFF G ++YV Sbjct: 394 DKMADEWESELEKLKAIP---HPKIQKSLQISYDSLQDDKYKNLFLHIACFFTGRDKDYV 450 Query: 211 VKILEH-DWHAKSGI 252 VK+L+ + +AK GI Sbjct: 451 VKVLDGCELYAKVGI 465 >ref|XP_002519358.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223541425|gb|EEF42975.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Length = 1108 Score = 56.6 bits (135), Expect = 2e-06 Identities = 31/62 (50%), Positives = 40/62 (64%) Frame = +1 Query: 40 IEIWRSALNSLTSQEGGLHSKVQDILQRSFNTLPFDSLKELFLHIACFFVGEYENYVVKI 219 IE+W SAL L E SK+Q IL+ S+++L D K LFL IACFF G +NYV+ I Sbjct: 409 IEVWESALQKL---EAVPDSKIQKILRVSYDSLEDDHDKNLFLDIACFFTGMEKNYVISI 465 Query: 220 LE 225 L+ Sbjct: 466 LQ 467