BLASTX nr result
ID: Atractylodes21_contig00028429
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00028429 (820 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524867.1| cysteine synthase, putative [Ricinus communi... 69 2e-09 emb|CAA57498.1| cysteine synthase [Arabidopsis thaliana] 62 4e-09 ref|XP_003632085.1| PREDICTED: cysteine synthase, chloroplastic/... 67 6e-09 ref|XP_002277485.1| PREDICTED: cysteine synthase, chloroplastic/... 67 6e-09 gb|ABK23421.1| unknown [Picea sitchensis] 66 8e-09 >ref|XP_002524867.1| cysteine synthase, putative [Ricinus communis] gi|223535830|gb|EEF37491.1| cysteine synthase, putative [Ricinus communis] Length = 408 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/48 (68%), Positives = 42/48 (87%) Frame = -3 Query: 593 LSNVGADLVLTDSSMGIK*AVQKADKIVNSTPHAHMLQQFDDPANPKV 450 L GA+LVLTDS+ G+K AVQKA++I+ STP+A+MLQQFD+PANPKV Sbjct: 195 LKAFGAELVLTDSAKGMKGAVQKAEEILKSTPNAYMLQQFDNPANPKV 242 >emb|CAA57498.1| cysteine synthase [Arabidopsis thaliana] Length = 424 Score = 62.0 bits (149), Expect(2) = 4e-09 Identities = 29/48 (60%), Positives = 39/48 (81%) Frame = -3 Query: 593 LSNVGADLVLTDSSMGIK*AVQKADKIVNSTPHAHMLQQFDDPANPKV 450 L GA+LVLTD + G+ AVQKA++I+ +TP A+MLQQFD+PANPK+ Sbjct: 210 LKAFGAELVLTDPAKGMTGAVQKAEEILKNTPDAYMLQQFDNPANPKI 257 Score = 25.4 bits (54), Expect(2) = 4e-09 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -2 Query: 753 CLNSLDKDGNNMIVDAEEKGEEKGITTPGK 664 C + D+ G +M+ DA E+KG +PGK Sbjct: 144 CCSVKDRIGYSMVTDA----EQKGFISPGK 169 >ref|XP_003632085.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic isoform 2 [Vitis vinifera] Length = 373 Score = 66.6 bits (161), Expect = 6e-09 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -3 Query: 593 LSNVGADLVLTDSSMGIK*AVQKADKIVNSTPHAHMLQQFDDPANPKV 450 L GA+LVLTD + G+K AVQKA++I+ STP+A+MLQQFD+PANPKV Sbjct: 169 LKAFGAELVLTDPAKGMKGAVQKAEEILKSTPNAYMLQQFDNPANPKV 216 >ref|XP_002277485.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic isoform 1 [Vitis vinifera] gi|296084309|emb|CBI24697.3| unnamed protein product [Vitis vinifera] Length = 382 Score = 66.6 bits (161), Expect = 6e-09 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -3 Query: 593 LSNVGADLVLTDSSMGIK*AVQKADKIVNSTPHAHMLQQFDDPANPKV 450 L GA+LVLTD + G+K AVQKA++I+ STP+A+MLQQFD+PANPKV Sbjct: 169 LKAFGAELVLTDPAKGMKGAVQKAEEILKSTPNAYMLQQFDNPANPKV 216 >gb|ABK23421.1| unknown [Picea sitchensis] Length = 401 Score = 66.2 bits (160), Expect = 8e-09 Identities = 30/44 (68%), Positives = 41/44 (93%) Frame = -3 Query: 581 GADLVLTDSSMGIK*AVQKADKIVNSTPHAHMLQQFDDPANPKV 450 GA+LVLT+++ G+K AVQKA++I+N TP+A+MLQQFD+PANPKV Sbjct: 192 GAELVLTEAAKGMKGAVQKAEEILNKTPNAYMLQQFDNPANPKV 235