BLASTX nr result
ID: Atractylodes21_contig00028345
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00028345 (441 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAH25579.1| reverse transcriptase [Trichosanthes cucumerina] 66 3e-09 emb|CAJ65846.1| putative reverse transcriptase [Cucumis melo] 64 1e-08 emb|CAN60374.1| hypothetical protein VITISV_001215 [Vitis vinifera] 63 3e-08 emb|CAN65540.1| hypothetical protein VITISV_029946 [Vitis vinifera] 62 4e-08 gb|AAB36266.1| retrotransposon peptide {Ty1-copia retrotransposo... 62 6e-08 >emb|CAH25579.1| reverse transcriptase [Trichosanthes cucumerina] Length = 79 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/46 (67%), Positives = 40/46 (86%), Gaps = 1/46 (2%) Frame = +3 Query: 117 MVCKLNKSLYGLRHASIQWYAKFSTFLLADGFVQSRSDYSL-LQRH 251 +VCKL+KS+YGL+ AS QW+AKFSTFL++ GF QS++DYSL LQ H Sbjct: 25 LVCKLHKSIYGLKQASRQWFAKFSTFLISLGFAQSKADYSLFLQGH 70 >emb|CAJ65846.1| putative reverse transcriptase [Cucumis melo] Length = 79 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/43 (65%), Positives = 37/43 (86%) Frame = +3 Query: 120 VCKLNKSLYGLRHASIQWYAKFSTFLLADGFVQSRSDYSLLQR 248 VCKL+KS+YGL+ AS QW+AKFS+FL++ GF QS++DYSL R Sbjct: 26 VCKLHKSIYGLKQASRQWFAKFSSFLISQGFQQSKADYSLFIR 68 >emb|CAN60374.1| hypothetical protein VITISV_001215 [Vitis vinifera] Length = 1535 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/47 (59%), Positives = 38/47 (80%) Frame = +3 Query: 108 EASMVCKLNKSLYGLRHASIQWYAKFSTFLLADGFVQSRSDYSLLQR 248 E ++VC+L+KSLYGL+ AS QW++KFS + A G+VQSR+DYSL R Sbjct: 1145 EENLVCRLHKSLYGLKQASRQWFSKFSKAIQAAGYVQSRADYSLFTR 1191 >emb|CAN65540.1| hypothetical protein VITISV_029946 [Vitis vinifera] Length = 1240 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = +3 Query: 111 ASMVCKLNKSLYGLRHASIQWYAKFSTFLLADGFVQSRSDYSL 239 ++ VCKL+KS+YGLR AS QW+AKFS L+++GF QS SDYSL Sbjct: 850 SNTVCKLHKSIYGLRQASRQWFAKFSGVLISEGFQQSHSDYSL 892 >gb|AAB36266.1| retrotransposon peptide {Ty1-copia retrotransposon element, clone Sat 30} [Vicia sativa, leaves, Peptide Transposon Partial, 75 aa] Length = 75 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = +3 Query: 108 EASMVCKLNKSLYGLRHASIQWYAKFSTFLLADGFVQSRSDYSL 239 +AS VCKL KSLYGL+ AS QWY+K STFL++ G+ QS +D+SL Sbjct: 18 DASKVCKLQKSLYGLKQASRQWYSKLSTFLISLGYSQSHADHSL 61