BLASTX nr result
ID: Atractylodes21_contig00028217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00028217 (375 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003599293.1| hypothetical protein MTR_3g031290 [Medicago ... 63 3e-08 >ref|XP_003599293.1| hypothetical protein MTR_3g031290 [Medicago truncatula] gi|355488341|gb|AES69544.1| hypothetical protein MTR_3g031290 [Medicago truncatula] Length = 282 Score = 62.8 bits (151), Expect = 3e-08 Identities = 39/105 (37%), Positives = 53/105 (50%), Gaps = 6/105 (5%) Frame = -3 Query: 373 RKVGDGCNTKFWVDEWLGSFKLADRFPRLFRLDRVQSCNVSDRVHNGAFIPD*SRPLRGG 194 +K+GDG +T FW D+WLGS L +RFPRLF L +S V+ G + R G Sbjct: 20 KKLGDGSDTLFWFDKWLGSVSLCERFPRLFDLAENKSITVAGLFSLG--VEQGGEAWRWG 77 Query: 193 ATILA-----AEEISTLVGGYGFG-NGGDSWVWSCDDMEGFTVKG 77 + A EE L+ + D WVW D +EG+TV+G Sbjct: 78 RRLWAWEEEELEECRALLTDVSLQVSVSDRWVWLPDPVEGYTVRG 122