BLASTX nr result
ID: Atractylodes21_contig00027934
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00027934 (338 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531250.1| transcription factor, putative [Ricinus comm... 61 8e-08 ref|XP_002285704.2| PREDICTED: transcription initiation factor T... 56 3e-06 >ref|XP_002531250.1| transcription factor, putative [Ricinus communis] gi|223529135|gb|EEF31114.1| transcription factor, putative [Ricinus communis] Length = 175 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = -1 Query: 335 GDEGGRSARKKTTPVPVAKPDVSEARTNARGLPERSDTDESDDSI 201 GD+ R+A KKTTP P AKPDV EA NA PERSD+DESDDS+ Sbjct: 132 GDQNARNASKKTTPAPAAKPDVQEAAANAEE-PERSDSDESDDSM 175 >ref|XP_002285704.2| PREDICTED: transcription initiation factor TFIID subunit 7-like [Vitis vinifera] Length = 205 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -1 Query: 335 GDEGGRSARKKTTPVPVAKPDVSEARTNARGLPERSDTDESDDSI 201 GDE R+A KK+ P P+ KPDV EA NA G P+RS++DESDDS+ Sbjct: 162 GDEHARNASKKSAPAPIPKPDVPEAGANA-GEPDRSESDESDDSM 205