BLASTX nr result
ID: Atractylodes21_contig00027902
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00027902 (1115 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528206.1| conserved hypothetical protein [Ricinus comm... 60 1e-06 >ref|XP_002528206.1| conserved hypothetical protein [Ricinus communis] gi|223532367|gb|EEF34163.1| conserved hypothetical protein [Ricinus communis] Length = 166 Score = 60.1 bits (144), Expect = 1e-06 Identities = 38/105 (36%), Positives = 55/105 (52%), Gaps = 4/105 (3%) Frame = -3 Query: 945 KRTVIRKNKNKNKKHMTRKDLIFNNVVSYLVTDSYMYNPLVCSQPTFDLPPPKPV----S 778 KR + K K RK L+ VV YL +DSY++ PL+ S P D + S Sbjct: 3 KRAALGVKKRKKPIKTNRKTLL-KKVVDYLKSDSYLFAPLISSSPRTDHFLASKIVSSTS 61 Query: 777 TSPGGEEEEMALPIGGRNKKFIEKVVDFLETDCYLYSPLLTKELV 643 +S EM + G+ K+F EKV D+L++D YLY+P+ +LV Sbjct: 62 SSTTTSAVEMKENMKGKKKRFAEKVGDYLKSDGYLYAPVFAPKLV 106