BLASTX nr result
ID: Atractylodes21_contig00027857
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00027857 (469 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004133786.1| PREDICTED: pentatricopeptide repeat-containi... 91 1e-16 ref|XP_002275952.1| PREDICTED: pentatricopeptide repeat-containi... 84 1e-14 ref|XP_002319140.1| predicted protein [Populus trichocarpa] gi|2... 83 2e-14 ref|XP_002319139.1| predicted protein [Populus trichocarpa] gi|2... 83 2e-14 ref|XP_003553325.1| PREDICTED: pentatricopeptide repeat-containi... 81 8e-14 >ref|XP_004133786.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial-like [Cucumis sativus] gi|449477985|ref|XP_004155184.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial-like [Cucumis sativus] Length = 485 Score = 90.5 bits (223), Expect = 1e-16 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = +2 Query: 2 PDRSSYVALVHGLFLNGMLEEAHKYHLEMKAKDLLPEPEIEERLQAWLAGK 154 PDRSSY+ L+HGLFLNG LE+AHKY+LEMK KDLLPEP+I+E LQ WLAGK Sbjct: 389 PDRSSYIVLIHGLFLNGKLEDAHKYYLEMKEKDLLPEPKIDEVLQTWLAGK 439 >ref|XP_002275952.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial-like [Vitis vinifera] Length = 566 Score = 84.0 bits (206), Expect = 1e-14 Identities = 35/52 (67%), Positives = 45/52 (86%) Frame = +2 Query: 2 PDRSSYVALVHGLFLNGMLEEAHKYHLEMKAKDLLPEPEIEERLQAWLAGKQ 157 PDRSSY+ L+HGLFLNG LEEA+KY++EMK K LPEP+ E+ LQAW++GK+ Sbjct: 460 PDRSSYIVLIHGLFLNGKLEEAYKYYIEMKEKQFLPEPKTEDMLQAWISGKE 511 >ref|XP_002319140.1| predicted protein [Populus trichocarpa] gi|222857516|gb|EEE95063.1| predicted protein [Populus trichocarpa] Length = 296 Score = 83.2 bits (204), Expect = 2e-14 Identities = 37/55 (67%), Positives = 44/55 (80%) Frame = +2 Query: 2 PDRSSYVALVHGLFLNGMLEEAHKYHLEMKAKDLLPEPEIEERLQAWLAGKQRPE 166 PDRSSY+ L+HGLFLNG L+ AHKY+ EMK K LLPEP+I+E LQ WL+ KQ E Sbjct: 180 PDRSSYIVLIHGLFLNGELDAAHKYYTEMKEKQLLPEPKIDEMLQTWLSNKQIAE 234 >ref|XP_002319139.1| predicted protein [Populus trichocarpa] gi|222857515|gb|EEE95062.1| predicted protein [Populus trichocarpa] Length = 518 Score = 83.2 bits (204), Expect = 2e-14 Identities = 37/55 (67%), Positives = 44/55 (80%) Frame = +2 Query: 2 PDRSSYVALVHGLFLNGMLEEAHKYHLEMKAKDLLPEPEIEERLQAWLAGKQRPE 166 PDRSSY+ L+HGLFLNG L+ AHKY+ EMK K LLPEP+I+E LQ WL+ KQ E Sbjct: 402 PDRSSYIVLIHGLFLNGELDAAHKYYTEMKEKQLLPEPKIDEMLQTWLSNKQIAE 456 >ref|XP_003553325.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial-like [Glycine max] Length = 516 Score = 81.3 bits (199), Expect = 8e-14 Identities = 36/54 (66%), Positives = 43/54 (79%) Frame = +2 Query: 5 DRSSYVALVHGLFLNGMLEEAHKYHLEMKAKDLLPEPEIEERLQAWLAGKQRPE 166 DRSSY+ L+HGLFLNG LEEAH Y+ EM+ K LPEP+ EE LQAW++GKQ E Sbjct: 410 DRSSYIVLIHGLFLNGKLEEAHTYYAEMQEKGFLPEPKTEEMLQAWVSGKQATE 463