BLASTX nr result
ID: Atractylodes21_contig00027768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00027768 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522055.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 >ref|XP_002522055.1| conserved hypothetical protein [Ricinus communis] gi|223538654|gb|EEF40255.1| conserved hypothetical protein [Ricinus communis] Length = 256 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = +1 Query: 58 MGSYTNTPNFDNLLLQTLMGRLQVHPPNPLQHQSSPSLNQTLESILLD 201 M S++NT NFDNLLLQTL+GRLQ+ PPN +P L+Q+LE +L D Sbjct: 1 MSSFSNTSNFDNLLLQTLLGRLQIRPPNAAH---NPLLSQSLEDLLFD 45