BLASTX nr result
ID: Atractylodes21_contig00027595
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00027595 (201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_861410.1| putative multifunctional pol protein [Cestrum y... 77 1e-12 ref|NP_068729.1| putative reverse transcriptase [Soybean chlorot... 72 6e-11 ref|NP_395469.1| putative reverse transcriptase [Blueberry red r... 66 3e-09 gb|AEQ49589.1| reverse transcriptase [Blueberry red ringspot virus] 66 3e-09 gb|AEQ38577.1| reverse transcriptase [Blueberry red ringspot virus] 66 3e-09 >ref|NP_861410.1| putative multifunctional pol protein [Cestrum yellow leaf curling virus] gi|75559686|sp|Q7TD08.1|POL_CYLCV RecName: Full=Enzymatic polyprotein; Includes: RecName: Full=Aspartic protease; Includes: RecName: Full=Endonuclease; Includes: RecName: Full=Reverse transcriptase gi|32305282|gb|AAP78924.1| putative multifunctional pol protein [Cestrum yellow leaf curling virus] Length = 643 Score = 77.0 bits (188), Expect = 1e-12 Identities = 34/51 (66%), Positives = 40/51 (78%) Frame = +3 Query: 48 LCRYVSGTLSSTEQNYSVHEKETLACLKTLKKWRIDLLPTRFELRTDSKYV 200 LC+Y SG SS EQ Y+VHEKETLA LKT++KW+ +LLP F LRTDS YV Sbjct: 541 LCKYTSGIFSSAEQKYTVHEKETLAALKTMRKWKAELLPKEFTLRTDSSYV 591 >ref|NP_068729.1| putative reverse transcriptase [Soybean chlorotic mottle virus] gi|18266821|sp|P15629.2|POL_SOCMV RecName: Full=Enzymatic polyprotein; Includes: RecName: Full=Aspartic protease; Includes: RecName: Full=Endonuclease; Includes: RecName: Full=Reverse transcriptase gi|11322953|emb|CAC16945.1| putative reverse transcriptase [Soybean chlorotic mottle virus] Length = 692 Score = 71.6 bits (174), Expect = 6e-11 Identities = 36/65 (55%), Positives = 45/65 (69%) Frame = +3 Query: 3 TNEITEYKTERFDLNLCRYVSGTLSSTEQNYSVHEKETLACLKTLKKWRIDLLPTRFELR 182 T+ ++ K +L LC+YVSGT + TE Y + E E LA +K L+KWRIDLL TRF LR Sbjct: 572 THVASKIKKLENELLLCKYVSGTFTDTETRYPIAELEVLAGVKVLEKWRIDLLQTRFLLR 631 Query: 183 TDSKY 197 TDSKY Sbjct: 632 TDSKY 636 >ref|NP_395469.1| putative reverse transcriptase [Blueberry red ringspot virus] gi|16033536|gb|AAL13274.1|AF404509_4 putative reverse transcriptase [Blueberry red ringspot virus] Length = 657 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/51 (56%), Positives = 38/51 (74%) Frame = +3 Query: 48 LCRYVSGTLSSTEQNYSVHEKETLACLKTLKKWRIDLLPTRFELRTDSKYV 200 L +Y SGT + TE+ Y +HE ETLA L+T +KW++DLL F L+TDSKYV Sbjct: 555 LTKYASGTFTDTEKRYPIHELETLAVLQTFRKWKVDLLSKPFILKTDSKYV 605 >gb|AEQ49589.1| reverse transcriptase [Blueberry red ringspot virus] Length = 657 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/51 (56%), Positives = 38/51 (74%) Frame = +3 Query: 48 LCRYVSGTLSSTEQNYSVHEKETLACLKTLKKWRIDLLPTRFELRTDSKYV 200 L +Y SGT + TE+ Y +HE ETLA L+T +KW++DLL F L+TDSKYV Sbjct: 555 LTKYASGTFTDTEKRYPIHELETLAVLQTFRKWKVDLLSKPFILKTDSKYV 605 >gb|AEQ38577.1| reverse transcriptase [Blueberry red ringspot virus] Length = 657 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/51 (56%), Positives = 38/51 (74%) Frame = +3 Query: 48 LCRYVSGTLSSTEQNYSVHEKETLACLKTLKKWRIDLLPTRFELRTDSKYV 200 L +Y SGT + TE+ Y +HE ETLA L+T +KW++DLL F L+TDSKYV Sbjct: 555 LTKYASGTFTDTEKRYPIHELETLAVLQTFRKWKVDLLSKPFILKTDSKYV 605