BLASTX nr result
ID: Atractylodes21_contig00027570
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00027570 (421 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529332.1| hypothetical protein RCOM_1016710 [Ricinus c... 62 5e-08 ref|XP_004151941.1| PREDICTED: uncharacterized protein LOC101209... 57 1e-06 >ref|XP_002529332.1| hypothetical protein RCOM_1016710 [Ricinus communis] gi|223531203|gb|EEF33049.1| hypothetical protein RCOM_1016710 [Ricinus communis] Length = 467 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/44 (59%), Positives = 38/44 (86%) Frame = -2 Query: 132 AGLSSFEPKDTTLPSLPTVEASISTLDSSPSYLRCKYCKGKLLR 1 AGL+S++P+D +LP+LP+++ +IS L+ SPSYLRCK C G+LLR Sbjct: 21 AGLASYDPEDPSLPNLPSLQDAISELEPSPSYLRCKSCNGRLLR 64 >ref|XP_004151941.1| PREDICTED: uncharacterized protein LOC101209977 [Cucumis sativus] gi|449490349|ref|XP_004158579.1| PREDICTED: uncharacterized protein LOC101227497 [Cucumis sativus] Length = 367 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/44 (54%), Positives = 34/44 (77%) Frame = -2 Query: 132 AGLSSFEPKDTTLPSLPTVEASISTLDSSPSYLRCKYCKGKLLR 1 A +SS++P +LP+LP+ +I+ LD SP YLRCK+CKG+LLR Sbjct: 21 ANISSYDPHHPSLPNLPSFNETIADLDPSPPYLRCKHCKGRLLR 64