BLASTX nr result
ID: Atractylodes21_contig00026771
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00026771 (440 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ33722.1| unnamed protein product [Thellungiella halophila] 57 2e-06 ref|XP_003537835.1| PREDICTED: UDP-galactose transporter 2-like ... 55 6e-06 >dbj|BAJ33722.1| unnamed protein product [Thellungiella halophila] Length = 348 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -2 Query: 88 ESEKKVSPVSDVGAWAMNVISSVGIIMAN 2 ESEKK SPVSDVGAWAMNVISSVGIIMAN Sbjct: 5 ESEKKQSPVSDVGAWAMNVISSVGIIMAN 33 >ref|XP_003537835.1| PREDICTED: UDP-galactose transporter 2-like [Glycine max] Length = 345 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 91 MESEKKVSPVSDVGAWAMNVISSVGIIMAN 2 MESEKK S +SDVGAWAMNV+SSVGIIMAN Sbjct: 1 MESEKKSSAISDVGAWAMNVVSSVGIIMAN 30