BLASTX nr result
ID: Atractylodes21_contig00026489
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00026489 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67349.1| hypothetical protein VITISV_018089 [Vitis vinifera] 87 1e-15 ref|XP_002269867.1| PREDICTED: pentatricopeptide repeat-containi... 87 1e-15 ref|XP_003531639.1| PREDICTED: pentatricopeptide repeat-containi... 74 1e-11 ref|XP_002320514.1| predicted protein [Populus trichocarpa] gi|2... 74 2e-11 ref|NP_194398.1| pentatricopeptide repeat-containing protein [Ar... 74 2e-11 >emb|CAN67349.1| hypothetical protein VITISV_018089 [Vitis vinifera] Length = 483 Score = 87.4 bits (215), Expect = 1e-15 Identities = 42/89 (47%), Positives = 61/89 (68%) Frame = -2 Query: 316 KCMIKSGCRPNEHTVKLLMSSFLQNDDYDGAYDVFKEMLERPVGPDSAILSDLCEGVSQV 137 K MI+SGC PN HT K+L+S+F +N+D+DGA +V +EM ER + PDS LS+LC G+ Sbjct: 380 KSMIRSGCHPNYHTFKMLISTFCKNEDFDGAVEVVREMSERSIAPDSDTLSELCRGLWLS 439 Query: 136 WKDMLVMKLSKEVDDGRLGVGRYEKVKSI 50 K+ L +KL KE++ L ++K K+I Sbjct: 440 GKEELALKLCKEMEMKHLMPEGFDKXKTI 468 >ref|XP_002269867.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like [Vitis vinifera] Length = 616 Score = 87.0 bits (214), Expect = 1e-15 Identities = 42/89 (47%), Positives = 61/89 (68%) Frame = -2 Query: 316 KCMIKSGCRPNEHTVKLLMSSFLQNDDYDGAYDVFKEMLERPVGPDSAILSDLCEGVSQV 137 K MI+SGC PN HT K+L+S+F +N+D+DGA +V +EM ER + PDS LS+LC G+ Sbjct: 513 KSMIRSGCHPNYHTFKMLISTFCKNEDFDGAVEVVREMSERSIAPDSDTLSELCRGLWLS 572 Query: 136 WKDMLVMKLSKEVDDGRLGVGRYEKVKSI 50 K+ L +KL KE++ L ++K K+I Sbjct: 573 GKEELALKLCKEMEMKHLMPEGFDKSKTI 601 >ref|XP_003531639.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like isoform 1 [Glycine max] gi|356526065|ref|XP_003531640.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like isoform 2 [Glycine max] Length = 522 Score = 74.3 bits (181), Expect = 1e-11 Identities = 33/87 (37%), Positives = 58/87 (66%) Frame = -2 Query: 316 KCMIKSGCRPNEHTVKLLMSSFLQNDDYDGAYDVFKEMLERPVGPDSAILSDLCEGVSQV 137 + M++SGC PN T ++L+S+F +N+D+DGA V ++ML R + PD + +S+LC+G+ + Sbjct: 424 RSMVRSGCSPNGQTFQMLISAFCKNEDFDGAVQVLRDMLGRLMSPDLSTMSELCDGLCRC 483 Query: 136 WKDMLVMKLSKEVDDGRLGVGRYEKVK 56 K+ L + L E++ RL ++K K Sbjct: 484 GKNQLALALCSEMEVRRLLPDGFDKEK 510 >ref|XP_002320514.1| predicted protein [Populus trichocarpa] gi|222861287|gb|EEE98829.1| predicted protein [Populus trichocarpa] Length = 478 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/78 (42%), Positives = 53/78 (67%) Frame = -2 Query: 316 KCMIKSGCRPNEHTVKLLMSSFLQNDDYDGAYDVFKEMLERPVGPDSAILSDLCEGVSQV 137 K M++SGC PNE T K+L S+F++N+D++GA++V +M R + DS L ++ +G+ Q Sbjct: 398 KSMVRSGCHPNEQTFKMLTSAFVKNEDFEGAFNVLMDMFARSMASDSNTLLEIYDGLCQC 457 Query: 136 WKDMLVMKLSKEVDDGRL 83 K+ L MKL E++ RL Sbjct: 458 GKENLAMKLCHEMEARRL 475 >ref|NP_194398.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|334186944|ref|NP_001190849.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75213515|sp|Q9SZ10.1|PP338_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g26680, mitochondrial; Flags: Precursor gi|4455191|emb|CAB36514.1| putative protein [Arabidopsis thaliana] gi|7269520|emb|CAB79523.1| putative protein [Arabidopsis thaliana] gi|332659836|gb|AEE85236.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332659837|gb|AEE85237.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 521 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/74 (44%), Positives = 49/74 (66%) Frame = -2 Query: 316 KCMIKSGCRPNEHTVKLLMSSFLQNDDYDGAYDVFKEMLERPVGPDSAILSDLCEGVSQV 137 K MI+SGC PNE T +L+S+F +N+D+DGA V +EM+ R + DS + +C G+ Sbjct: 437 KSMIRSGCHPNEQTFNMLVSAFCRNEDFDGASQVLREMVRRSIPLDSRTVHQVCNGLKHQ 496 Query: 136 WKDMLVMKLSKEVD 95 KD LV KL +E++ Sbjct: 497 GKDQLVKKLLQEME 510