BLASTX nr result
ID: Atractylodes21_contig00026424
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00026424 (352 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513132.1| Aspartic proteinase nepenthesin-1 precursor,... 56 4e-06 >ref|XP_002513132.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus communis] gi|223548143|gb|EEF49635.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus communis] Length = 481 Score = 55.8 bits (133), Expect = 4e-06 Identities = 42/118 (35%), Positives = 59/118 (50%), Gaps = 3/118 (2%) Frame = +3 Query: 6 QFLAVQEIINITKSASHVPHTQLFDHEILDTDESHDGKRWKLNLVHRDKLS---ENDDGH 176 Q L V+E I TK++ + +LFD++ D +GK WKL LVHRDK++ ++ H Sbjct: 39 QLLNVKEAITETKASQY---QELFDNQ---NDTLTEGK-WKLKLVHRDKITAFNKSSYDH 91 Query: 177 XXXXXXXXXXXXXXAAILNSRIAXXXXXXXXXXXXRFEVADFGSEVVSGMQQGSGEYF 350 A L R++ + V +FG+EVVSGM QGSGEYF Sbjct: 92 SHNFHARIQRDKKRVATLIRRLSPRDATSS------YSVEEFGAEVVSGMNQGSGEYF 143