BLASTX nr result
ID: Atractylodes21_contig00026298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00026298 (424 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301195.1| predicted protein [Populus trichocarpa] gi|2... 63 3e-08 ref|XP_002460354.1| hypothetical protein SORBIDRAFT_02g026818 [S... 61 1e-07 ref|XP_002510258.1| Patatin T5 precursor, putative [Ricinus comm... 60 2e-07 ref|XP_002282366.2| PREDICTED: patatin group A-3-like [Vitis vin... 59 4e-07 ref|XP_002282415.2| PREDICTED: patatin group A-3-like [Vitis vin... 59 4e-07 >ref|XP_002301195.1| predicted protein [Populus trichocarpa] gi|222842921|gb|EEE80468.1| predicted protein [Populus trichocarpa] Length = 408 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = +3 Query: 3 GRFLVLSLGTGSPKFQERYDATKSSSWGILGRLAGGGSTP 122 GRFL++SLGTGSPK QE+Y AT+++ WG+LG L GGSTP Sbjct: 252 GRFLLISLGTGSPKAQEKYKATEAAKWGLLGWLTSGGSTP 291 >ref|XP_002460354.1| hypothetical protein SORBIDRAFT_02g026818 [Sorghum bicolor] gi|241923731|gb|EER96875.1| hypothetical protein SORBIDRAFT_02g026818 [Sorghum bicolor] Length = 373 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +3 Query: 3 GRFLVLSLGTGSPKFQERYDATKSSSWGILGRLAGGGSTP 122 GRFLV+SLGTGS KF+ Y+A K+ SWG+LG L G GSTP Sbjct: 250 GRFLVISLGTGSAKFEANYNAQKAKSWGVLGWLLGSGSTP 289 >ref|XP_002510258.1| Patatin T5 precursor, putative [Ricinus communis] gi|223550959|gb|EEF52445.1| Patatin T5 precursor, putative [Ricinus communis] Length = 411 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +3 Query: 3 GRFLVLSLGTGSPKFQERYDATKSSSWGILGRLAGGGSTP 122 GRFLV+S+GTGSPK +Y+A K+S WG+LG L GGSTP Sbjct: 254 GRFLVISIGTGSPKAARKYNAIKASKWGVLGWLNSGGSTP 293 >ref|XP_002282366.2| PREDICTED: patatin group A-3-like [Vitis vinifera] Length = 411 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = +3 Query: 3 GRFLVLSLGTGSPKFQERYDATKSSSWGILGRLAGGGSTP 122 GRFLV+S+GTGSPK +++Y+A +S WG+LG L GGSTP Sbjct: 255 GRFLVISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTP 294 >ref|XP_002282415.2| PREDICTED: patatin group A-3-like [Vitis vinifera] Length = 406 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = +3 Query: 3 GRFLVLSLGTGSPKFQERYDATKSSSWGILGRLAGGGSTP 122 GRFLV+S+GTGSPK +++Y+A +S WG+LG L GGSTP Sbjct: 250 GRFLVISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTP 289