BLASTX nr result
ID: Atractylodes21_contig00026294
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00026294 (319 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002464034.1| hypothetical protein SORBIDRAFT_01g010950 [S... 57 2e-06 >ref|XP_002464034.1| hypothetical protein SORBIDRAFT_01g010950 [Sorghum bicolor] gi|241917888|gb|EER91032.1| hypothetical protein SORBIDRAFT_01g010950 [Sorghum bicolor] Length = 168 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = +1 Query: 4 GSNVDVFENEQPARPKRKTADGLVIYSEDELGIGKADAGGTRL 132 G + D E + RP+R+TADGLVIYS DELG GKADAGGT L Sbjct: 117 GDDDDDEEEFEEKRPRRRTADGLVIYSADELGFGKADAGGTPL 159