BLASTX nr result
ID: Atractylodes21_contig00026264
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00026264 (386 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002889076.1| integral membrane family protein [Arabidopsi... 75 4e-12 ref|NP_177760.1| golgi nucleotide sugar transporter 3 [Arabidops... 75 6e-12 gb|ACD56609.1| putative integral membrane protein [Gossypioides ... 75 7e-12 gb|ABO41833.1| putative integral membrane protein [Gossypium rai... 75 7e-12 ref|XP_004139859.1| PREDICTED: GDP-mannose transporter GONST3-li... 74 1e-11 >ref|XP_002889076.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata] gi|297334917|gb|EFH65335.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata] Length = 372 Score = 75.5 bits (184), Expect = 4e-12 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +3 Query: 3 VVINLMIWDKHSTHIGTIGLLICMFGGVMYQQSTSKKPKPA 125 VVINL++WDKHST +GT+GLLICMFGGVMYQQST KKP A Sbjct: 293 VVINLVVWDKHSTFVGTLGLLICMFGGVMYQQSTMKKPNTA 333 >ref|NP_177760.1| golgi nucleotide sugar transporter 3 [Arabidopsis thaliana] gi|75198562|sp|Q9S845.1|GONS3_ARATH RecName: Full=GDP-mannose transporter GONST3; AltName: Full=Protein GOLGI NUCLEOTIDE SUGAR TRANSPORTER 3 gi|6554485|gb|AAF16667.1|AC012394_16 unknown protein; 69155-70273 [Arabidopsis thaliana] gi|6573714|gb|AAF17634.1|AC009978_10 T23E18.26 [Arabidopsis thaliana] gi|29329821|emb|CAD83087.1| GONST3 Golgi Nucleotide sugar transporter [Arabidopsis thaliana] gi|332197705|gb|AEE35826.1| golgi nucleotide sugar transporter 3 [Arabidopsis thaliana] Length = 372 Score = 75.1 bits (183), Expect = 6e-12 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +3 Query: 3 VVINLMIWDKHSTHIGTIGLLICMFGGVMYQQSTSKKP 116 VVINLM+WDKHST +GT+GLL+CMFGGVMYQQST KKP Sbjct: 293 VVINLMVWDKHSTFVGTLGLLVCMFGGVMYQQSTIKKP 330 >gb|ACD56609.1| putative integral membrane protein [Gossypioides kirkii] Length = 371 Score = 74.7 bits (182), Expect = 7e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +3 Query: 3 VVINLMIWDKHSTHIGTIGLLICMFGGVMYQQSTSKKPK 119 VVINL+IWDKHST +GT+GLLICM GGVMYQQSTS KPK Sbjct: 294 VVINLVIWDKHSTFVGTVGLLICMLGGVMYQQSTSSKPK 332 >gb|ABO41833.1| putative integral membrane protein [Gossypium raimondii] Length = 369 Score = 74.7 bits (182), Expect = 7e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +3 Query: 3 VVINLMIWDKHSTHIGTIGLLICMFGGVMYQQSTSKKPK 119 VVINL+IWDKHST +GT+GLLICM GGVMYQQSTS KPK Sbjct: 294 VVINLVIWDKHSTFVGTVGLLICMLGGVMYQQSTSSKPK 332 >ref|XP_004139859.1| PREDICTED: GDP-mannose transporter GONST3-like [Cucumis sativus] gi|449521993|ref|XP_004168013.1| PREDICTED: GDP-mannose transporter GONST3-like [Cucumis sativus] Length = 378 Score = 73.9 bits (180), Expect = 1e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +3 Query: 3 VVINLMIWDKHSTHIGTIGLLICMFGGVMYQQSTSKKPKPA 125 VVINL+IWDKHST IGT+GLLICM GG++YQQSTS KPK A Sbjct: 300 VVINLVIWDKHSTFIGTVGLLICMSGGILYQQSTSSKPKAA 340