BLASTX nr result
ID: Atractylodes21_contig00026260
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00026260 (482 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003621507.1| F-box/LRR-repeat protein [Medicago truncatul... 63 3e-08 gb|ABN05895.1| hypothetical protein MtrDRAFT_AC149039g12v2 [Medi... 63 3e-08 ref|XP_003638621.1| F-box/LRR-repeat protein [Medicago truncatul... 62 4e-08 ref|XP_003627163.1| F-box/FBD/LRR-repeat protein [Medicago trunc... 61 8e-08 ref|XP_003533017.1| PREDICTED: F-box/FBD/LRR-repeat protein At3g... 59 5e-07 >ref|XP_003621507.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355496522|gb|AES77725.1| F-box/LRR-repeat protein [Medicago truncatula] Length = 518 Score = 62.8 bits (151), Expect = 3e-08 Identities = 45/147 (30%), Positives = 66/147 (44%), Gaps = 6/147 (4%) Frame = -3 Query: 462 SNWFADFFSNFPLIENLFLQIPIQYNNLKVSSDSLRKFVVTQSCDLKGIEIDAPNLLSFE 283 + WF + F FP +E+L L + +SS L+ ++ D+K I IDAPNLLSF Sbjct: 223 NKWFLELFPKFPFLESLELDSCTMSEKINISSVQLKVLEISFCSDMKEINIDAPNLLSFV 282 Query: 282 Y----SGDSHPLSFPSASTSGQLKACMECYPRYTVGTFWFETLRRFLDKNNGFKVLKLHI 115 Y G S P+ +S QLK M + Y + + N L ++I Sbjct: 283 YYSVGCGSSDPI-ISYLRSSSQLKVYMNFFIDYYHHLCNLREFVQNIKPQNVLSSLSIYI 341 Query: 114 STAFINVAYPKAMQ--SPPFELEHVEL 40 F +V P Q SPP ++H+ L Sbjct: 342 RKPFEDVQQPVVFQASSPPPSIKHLHL 368 >gb|ABN05895.1| hypothetical protein MtrDRAFT_AC149039g12v2 [Medicago truncatula] Length = 469 Score = 62.8 bits (151), Expect = 3e-08 Identities = 45/147 (30%), Positives = 66/147 (44%), Gaps = 6/147 (4%) Frame = -3 Query: 462 SNWFADFFSNFPLIENLFLQIPIQYNNLKVSSDSLRKFVVTQSCDLKGIEIDAPNLLSFE 283 + WF + F FP +E+L L + +SS L+ ++ D+K I IDAPNLLSF Sbjct: 223 NKWFLELFPKFPFLESLELDSCTMSEKINISSVQLKVLEISFCSDMKEINIDAPNLLSFV 282 Query: 282 Y----SGDSHPLSFPSASTSGQLKACMECYPRYTVGTFWFETLRRFLDKNNGFKVLKLHI 115 Y G S P+ +S QLK M + Y + + N L ++I Sbjct: 283 YYSVGCGSSDPI-ISYLRSSSQLKVYMNFFIDYYHHLCNLREFVQNIKPQNVLSSLSIYI 341 Query: 114 STAFINVAYPKAMQ--SPPFELEHVEL 40 F +V P Q SPP ++H+ L Sbjct: 342 RKPFEDVQQPVVFQASSPPPSIKHLHL 368 >ref|XP_003638621.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355504556|gb|AES85759.1| F-box/LRR-repeat protein [Medicago truncatula] Length = 491 Score = 62.4 bits (150), Expect = 4e-08 Identities = 46/147 (31%), Positives = 68/147 (46%), Gaps = 6/147 (4%) Frame = -3 Query: 456 WFADFFSNFPLIENLFLQIPIQYNNLKVSSDSLRKFVVTQSCDLKGIEIDAPNLLSFEYS 277 WF + F FP +E+L L + +SSD L+ ++ +LK + IDAPNLLS Y Sbjct: 310 WFLELFPKFPFLESLKLNNCTMAERIDISSDQLKVLGLSNCSNLKEVNIDAPNLLSCVYH 369 Query: 276 GD-SHPLSFPSASTSGQLKACMECYPRYTVGTFWFETLRRFLDK---NNGFKVLKLHIST 109 GD S +S QLK M+ +++ LR F+ N L L I Sbjct: 370 GDCSLETIISFLRSSSQLKVDMD----FSIDYRHLCNLREFVQNIKPQNVLSSLSLFIFK 425 Query: 108 AFINVAYPKAMQ--SPPFELEHVELKF 34 +V +P Q SPP ++H+ L + Sbjct: 426 RIADVLHPMVFQVSSPPPSIKHLHLLY 452 >ref|XP_003627163.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] gi|355521185|gb|AET01639.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] Length = 600 Score = 61.2 bits (147), Expect = 8e-08 Identities = 44/147 (29%), Positives = 70/147 (47%), Gaps = 7/147 (4%) Frame = -3 Query: 456 WFADFFSNFPLIENLFLQIPIQYNNLKVSSDSLRKFVVTQSCDLKGIEIDAPNLLSFEY- 280 WF + F F +E+L L + +SS L+ ++ +LK + IDAPNLLS Y Sbjct: 298 WFLELFRKFRFLESLKLDDCTMAERINISSVQLKVLELSDCSNLKEVNIDAPNLLSCVYC 357 Query: 279 -SGDSHPLSFPSASTSGQLKACMECYPRYTVGTFWFETLRRFLDK---NNGFKVLKLHIS 112 GDS P+ ++S QLK M+ + LR F+ N L ++I Sbjct: 358 SDGDSEPI-ISFLTSSSQLKVDMD----IPIDHHHLCNLREFVQNIKPQNVLSSLSVYIR 412 Query: 111 TAFINVAYPKAMQ--SPPFELEHVELK 37 F+++ +P Q SPP ++H+ L+ Sbjct: 413 KPFVDILHPMVFQVSSPPPSIKHLHLR 439 >ref|XP_003533017.1| PREDICTED: F-box/FBD/LRR-repeat protein At3g51530-like [Glycine max] Length = 370 Score = 58.5 bits (140), Expect = 5e-07 Identities = 33/86 (38%), Positives = 51/86 (59%), Gaps = 3/86 (3%) Frame = -3 Query: 459 NWFADFFSNFPLIENLFLQIPIQYNNLKVSSDSLRKFVVTQSCDLKGIEIDAPNLLSFEY 280 NWF D F FP +++L + +SS L+ ++ +LK + IDAPNLLS EY Sbjct: 121 NWFLDLFPKFPFLDSLKFSFCKMSETINISSAQLKVLELSNCSNLKEVNIDAPNLLSCEY 180 Query: 279 SGD--SHP-LSFPSASTSGQLKACME 211 SG S P +SF ++S++ ++KA +E Sbjct: 181 SGGGASKPIISFLNSSSNLEVKAFIE 206