BLASTX nr result
ID: Atractylodes21_contig00026209
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00026209 (383 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519066.1| ubiquitin conjugating enzyme, putative [Rici... 58 7e-07 >ref|XP_002519066.1| ubiquitin conjugating enzyme, putative [Ricinus communis] gi|223541729|gb|EEF43277.1| ubiquitin conjugating enzyme, putative [Ricinus communis] Length = 925 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +3 Query: 27 KGNSTGFKIMLSKLVPKLVEAFTAKGFDCGEYSK 128 KGNSTGFKIMLSKL PKLVEAF AKG DC ++++ Sbjct: 889 KGNSTGFKIMLSKLFPKLVEAFAAKGIDCNKFAE 922