BLASTX nr result
ID: Atractylodes21_contig00026054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00026054 (207 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003572228.1| PREDICTED: vacuolar protein sorting-associat... 100 1e-19 ref|XP_002453644.1| hypothetical protein SORBIDRAFT_04g009820 [S... 100 1e-19 gb|ACG43769.1| vacuolar protein sorting 29 [Zea mays] 100 1e-19 ref|NP_001147749.1| vacuolar protein sorting 29 [Zea mays] gi|19... 100 1e-19 ref|XP_003519451.1| PREDICTED: vacuolar protein sorting-associat... 100 2e-19 >ref|XP_003572228.1| PREDICTED: vacuolar protein sorting-associated protein 29-like [Brachypodium distachyon] Length = 188 Score = 100 bits (249), Expect = 1e-19 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = +3 Query: 69 AIGDLHIPHRAPDLPAKFKSMLVPGKIQHIICTGNLCIKEVHDYLK 206 A+GDLHIPHRAPDLPAKFKSMLVPGKIQHIICTGNLCIKEVHDYLK Sbjct: 6 ALGDLHIPHRAPDLPAKFKSMLVPGKIQHIICTGNLCIKEVHDYLK 51 >ref|XP_002453644.1| hypothetical protein SORBIDRAFT_04g009820 [Sorghum bicolor] gi|241933475|gb|EES06620.1| hypothetical protein SORBIDRAFT_04g009820 [Sorghum bicolor] Length = 188 Score = 100 bits (249), Expect = 1e-19 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = +3 Query: 69 AIGDLHIPHRAPDLPAKFKSMLVPGKIQHIICTGNLCIKEVHDYLK 206 A+GDLHIPHRAPDLPAKFKSMLVPGKIQHIICTGNLCIKEVHDYLK Sbjct: 6 ALGDLHIPHRAPDLPAKFKSMLVPGKIQHIICTGNLCIKEVHDYLK 51 >gb|ACG43769.1| vacuolar protein sorting 29 [Zea mays] Length = 188 Score = 100 bits (249), Expect = 1e-19 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = +3 Query: 69 AIGDLHIPHRAPDLPAKFKSMLVPGKIQHIICTGNLCIKEVHDYLK 206 A+GDLHIPHRAPDLPAKFKSMLVPGKIQHIICTGNLCIKEVHDYLK Sbjct: 6 ALGDLHIPHRAPDLPAKFKSMLVPGKIQHIICTGNLCIKEVHDYLK 51 >ref|NP_001147749.1| vacuolar protein sorting 29 [Zea mays] gi|195613446|gb|ACG28553.1| vacuolar protein sorting 29 [Zea mays] gi|413925910|gb|AFW65842.1| vacuolar protein sorting 29 [Zea mays] Length = 188 Score = 100 bits (249), Expect = 1e-19 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = +3 Query: 69 AIGDLHIPHRAPDLPAKFKSMLVPGKIQHIICTGNLCIKEVHDYLK 206 A+GDLHIPHRAPDLPAKFKSMLVPGKIQHIICTGNLCIKEVHDYLK Sbjct: 6 ALGDLHIPHRAPDLPAKFKSMLVPGKIQHIICTGNLCIKEVHDYLK 51 >ref|XP_003519451.1| PREDICTED: vacuolar protein sorting-associated protein 29-like [Glycine max] Length = 167 Score = 100 bits (248), Expect = 2e-19 Identities = 44/46 (95%), Positives = 46/46 (100%) Frame = +3 Query: 69 AIGDLHIPHRAPDLPAKFKSMLVPGKIQHIICTGNLCIKEVHDYLK 206 A+GDLHIPHRAPDLPAKFKSMLVPGKIQHIICTGNLCIKE+HDYLK Sbjct: 6 ALGDLHIPHRAPDLPAKFKSMLVPGKIQHIICTGNLCIKEIHDYLK 51