BLASTX nr result
ID: Atractylodes21_contig00025919
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00025919 (382 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514989.1| conserved hypothetical protein [Ricinus comm... 103 1e-20 ref|XP_002315625.1| predicted protein [Populus trichocarpa] gi|2... 101 6e-20 ref|XP_002312638.1| predicted protein [Populus trichocarpa] gi|2... 101 7e-20 ref|XP_003631322.1| PREDICTED: uncharacterized protein LOC100853... 97 1e-18 gb|AAO42108.1| unknown protein [Arabidopsis thaliana] 96 2e-18 >ref|XP_002514989.1| conserved hypothetical protein [Ricinus communis] gi|223546040|gb|EEF47543.1| conserved hypothetical protein [Ricinus communis] Length = 358 Score = 103 bits (257), Expect = 1e-20 Identities = 48/64 (75%), Positives = 58/64 (90%) Frame = +3 Query: 54 LKSRSQEKYTNKLASTRRIAEEKRAKAEVNLNEQAVKTSERADYIRRTGHLPSSFSVKLP 233 +K+R+QEK T+KLA+T+R+AEEKRA AE LNE+AV+T+ERADYIRRTGHLPSSFS KLP Sbjct: 295 IKARAQEKLTSKLATTKRMAEEKRANAEAKLNEKAVRTAERADYIRRTGHLPSSFSFKLP 354 Query: 234 SCCW 245 S CW Sbjct: 355 SLCW 358 >ref|XP_002315625.1| predicted protein [Populus trichocarpa] gi|222864665|gb|EEF01796.1| predicted protein [Populus trichocarpa] Length = 351 Score = 101 bits (252), Expect = 6e-20 Identities = 49/64 (76%), Positives = 54/64 (84%) Frame = +3 Query: 54 LKSRSQEKYTNKLASTRRIAEEKRAKAEVNLNEQAVKTSERADYIRRTGHLPSSFSVKLP 233 LK+R+QE+ NKLAST RIAEEKR+ AE LNE+AVKTSE ADYIRRTGHLPSSFS K P Sbjct: 288 LKARAQERLANKLASTTRIAEEKRSNAEATLNEKAVKTSETADYIRRTGHLPSSFSFKFP 347 Query: 234 SCCW 245 S CW Sbjct: 348 SLCW 351 >ref|XP_002312638.1| predicted protein [Populus trichocarpa] gi|222852458|gb|EEE90005.1| predicted protein [Populus trichocarpa] Length = 366 Score = 101 bits (251), Expect = 7e-20 Identities = 48/64 (75%), Positives = 56/64 (87%) Frame = +3 Query: 54 LKSRSQEKYTNKLASTRRIAEEKRAKAEVNLNEQAVKTSERADYIRRTGHLPSSFSVKLP 233 LK+R+QE+ NKLAST+RIAEEKRA AE LNE+AVKTSE+AD++R TGHLPSSFS KLP Sbjct: 303 LKARAQERLANKLASTKRIAEEKRANAEAKLNEKAVKTSEKADHMRTTGHLPSSFSFKLP 362 Query: 234 SCCW 245 S CW Sbjct: 363 SLCW 366 >ref|XP_003631322.1| PREDICTED: uncharacterized protein LOC100853782 [Vitis vinifera] Length = 359 Score = 97.1 bits (240), Expect = 1e-18 Identities = 47/64 (73%), Positives = 53/64 (82%) Frame = +3 Query: 54 LKSRSQEKYTNKLASTRRIAEEKRAKAEVNLNEQAVKTSERADYIRRTGHLPSSFSVKLP 233 LK+ +QEK NK+A+TRRIAEEKRA AE LNE+A +TSERADYIRRTG LPSSF KLP Sbjct: 296 LKAWAQEKLANKIAATRRIAEEKRASAEAKLNEKAARTSERADYIRRTGRLPSSFYFKLP 355 Query: 234 SCCW 245 S CW Sbjct: 356 SLCW 359 >gb|AAO42108.1| unknown protein [Arabidopsis thaliana] Length = 210 Score = 96.3 bits (238), Expect = 2e-18 Identities = 47/66 (71%), Positives = 57/66 (86%), Gaps = 2/66 (3%) Frame = +3 Query: 54 LKSRSQEKYTNKLASTRRIAEEKRAKAEVNLNEQAVKTSERADYIRRTGHLPS--SFSVK 227 +K+R++EK NKLA+T+RIAEE+RA AE LNE+AVKTSE+ADYIRR+GHLPS SFS K Sbjct: 143 MKARAEEKLANKLAATKRIAEERRANAEAKLNEKAVKTSEKADYIRRSGHLPSSFSFSFK 202 Query: 228 LPSCCW 245 LPS CW Sbjct: 203 LPSRCW 208