BLASTX nr result
ID: Atractylodes21_contig00025835
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00025835 (293 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFC36356.1| 2-oxoglutarate-dependent dioxygenase [Salvia milt... 59 3e-07 >gb|AFC36356.1| 2-oxoglutarate-dependent dioxygenase [Salvia miltiorrhiza] Length = 316 Score = 59.3 bits (142), Expect = 3e-07 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = -3 Query: 291 FKPFDHLKYLDFYNREENRKLESAIRTYCGV 199 +KPFDHLK+LDF+++EENR+LESAI TYCGV Sbjct: 284 YKPFDHLKFLDFFSQEENRRLESAITTYCGV 314