BLASTX nr result
ID: Atractylodes21_contig00025660
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00025660 (259 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519503.1| hypothetical protein RCOM_1355100 [Ricinus c... 73 3e-11 ref|XP_002326193.1| predicted protein [Populus trichocarpa] gi|2... 72 5e-11 ref|XP_002881483.1| hypothetical protein ARALYDRAFT_482681 [Arab... 70 2e-10 emb|CBI32764.3| unnamed protein product [Vitis vinifera] 70 2e-10 ref|NP_973616.1| DVL family protein [Arabidopsis thaliana] gi|32... 69 3e-10 >ref|XP_002519503.1| hypothetical protein RCOM_1355100 [Ricinus communis] gi|223541366|gb|EEF42917.1| hypothetical protein RCOM_1355100 [Ricinus communis] Length = 175 Score = 72.8 bits (177), Expect = 3e-11 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = -2 Query: 117 RTFGEKCSHIAKKQRAKFYIVRRCIAMLVCWHEKEK 10 R+FG+KCSH+ KKQRAKFYI+RRCIAMLVCWHE+E+ Sbjct: 137 RSFGQKCSHLVKKQRAKFYILRRCIAMLVCWHERER 172 >ref|XP_002326193.1| predicted protein [Populus trichocarpa] gi|222833386|gb|EEE71863.1| predicted protein [Populus trichocarpa] Length = 56 Score = 72.0 bits (175), Expect = 5e-11 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -2 Query: 117 RTFGEKCSHIAKKQRAKFYIVRRCIAMLVCWHEKEK 10 R+FG+KCSH+ KKQR KFYIVRRCIAML+CWHE+E+ Sbjct: 18 RSFGQKCSHLVKKQRGKFYIVRRCIAMLICWHERER 53 >ref|XP_002881483.1| hypothetical protein ARALYDRAFT_482681 [Arabidopsis lyrata subsp. lyrata] gi|297327322|gb|EFH57742.1| hypothetical protein ARALYDRAFT_482681 [Arabidopsis lyrata subsp. lyrata] Length = 53 Score = 70.1 bits (170), Expect = 2e-10 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -2 Query: 117 RTFGEKCSHIAKKQRAKFYIVRRCIAMLVCWHE 19 +TFG+KCSH+ KKQRAKFYIVRRCIAMLVCWH+ Sbjct: 13 KTFGQKCSHVVKKQRAKFYIVRRCIAMLVCWHD 45 >emb|CBI32764.3| unnamed protein product [Vitis vinifera] Length = 59 Score = 69.7 bits (169), Expect = 2e-10 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -2 Query: 123 RNRTFGEKCSHIAKKQRAKFYIVRRCIAMLVCWHEK 16 R ++FG+KCSH+ KKQRAKFYI+RRCIAMLVCWHE+ Sbjct: 21 RCKSFGQKCSHLVKKQRAKFYILRRCIAMLVCWHER 56 >ref|NP_973616.1| DVL family protein [Arabidopsis thaliana] gi|32400647|dbj|BAC78810.1| hypothetical protein [Arabidopsis thaliana] gi|42822065|tpg|DAA02287.1| TPA_exp: DVL16 [Arabidopsis thaliana] gi|109134191|gb|ABG25093.1| At2g36985 [Arabidopsis thaliana] gi|330254237|gb|AEC09331.1| DVL family protein [Arabidopsis thaliana] Length = 53 Score = 69.3 bits (168), Expect = 3e-10 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -2 Query: 117 RTFGEKCSHIAKKQRAKFYIVRRCIAMLVCWHEK 16 +TFG+KCSH+ KKQRAKFYI+RRCIAMLVCWH++ Sbjct: 13 KTFGQKCSHVVKKQRAKFYILRRCIAMLVCWHDQ 46