BLASTX nr result
ID: Atractylodes21_contig00025352
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00025352 (276 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_194671.1| F-box/LRR-repeat protein [Arabidopsis thaliana]... 60 2e-07 dbj|BAC42265.1| unknown protein [Arabidopsis thaliana] 60 2e-07 ref|XP_002530188.1| conserved hypothetical protein [Ricinus comm... 58 7e-07 >ref|NP_194671.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|75264516|sp|Q9M0E1.1|FBL77_ARATH RecName: Full=F-box/LRR-repeat protein At4g29420 gi|7269841|emb|CAB79700.1| hypothetical protein [Arabidopsis thaliana] gi|109946621|gb|ABG48489.1| At4g29420 [Arabidopsis thaliana] gi|332660229|gb|AEE85629.1| F-box/LRR-repeat protein [Arabidopsis thaliana] Length = 446 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/82 (36%), Positives = 51/82 (62%) Frame = +3 Query: 30 NTESTKVTAESLRTFDTLYPDLRSINFQCSW*RYIKSRSRVSNSSQIVTPLKTIFLNLVS 209 ++ES + +T ++L ++R++N C+W RY+KSRS V +VTP KTIF +L+ Sbjct: 18 DSESLARCRVASKTLNSLSREVRAVNLICTWSRYLKSRSIV-----VVTPFKTIFRSLIE 72 Query: 210 NLRVVDSVCIGTKKPLRDVSYD 275 N + S+ +G K L+ +S+D Sbjct: 73 NSSKIRSISVGVDKALKGMSFD 94 >dbj|BAC42265.1| unknown protein [Arabidopsis thaliana] Length = 446 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/82 (36%), Positives = 51/82 (62%) Frame = +3 Query: 30 NTESTKVTAESLRTFDTLYPDLRSINFQCSW*RYIKSRSRVSNSSQIVTPLKTIFLNLVS 209 ++ES + +T ++L ++R++N C+W RY+KSRS V +VTP KTIF +L+ Sbjct: 18 DSESLARCRVASKTLNSLSREVRAVNLICTWSRYLKSRSIV-----VVTPFKTIFRSLIE 72 Query: 210 NLRVVDSVCIGTKKPLRDVSYD 275 N + S+ +G K L+ +S+D Sbjct: 73 NSSKIRSISVGVDKALKGMSFD 94 >ref|XP_002530188.1| conserved hypothetical protein [Ricinus communis] gi|223530307|gb|EEF32202.1| conserved hypothetical protein [Ricinus communis] Length = 460 Score = 58.2 bits (139), Expect = 7e-07 Identities = 40/88 (45%), Positives = 55/88 (62%), Gaps = 5/88 (5%) Frame = +3 Query: 27 RNTESTKVTAESL--RTFDTL-YPDLRSINFQCSW*RYIKSRSRVSNSSQIVTPLKTIFL 197 R T+ST++ L +TF+ L + D+RSIN C+ RY+KSRS N+ +TP K IF Sbjct: 15 RLTDSTELARCRLVSKTFNKLIFSDIRSINLTCTLSRYLKSRS--PNTKDQITPFKRIFN 72 Query: 198 NLV--SNLRVVDSVCIGTKKPLRDVSYD 275 LV S+ VVDSV IG +K L ++YD Sbjct: 73 RLVNRSDSLVVDSVTIGVEKSLCGITYD 100