BLASTX nr result
ID: Atractylodes21_contig00025322
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00025322 (539 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD45096.2| ribosomal protein S2 [Amborella trichopoda] 70 2e-10 gb|AEX99504.1| ribosomal protein S2 (chloroplast) [Chrysanthemum... 69 5e-10 ref|YP_007353756.1| ribosomal protein S2 (chloroplast) [Chrysant... 69 5e-10 ref|YP_398848.1| ribosomal protein S2 [Nicotiana tomentosiformis... 69 5e-10 ref|YP_398319.1| ribosomal protein S2 [Lactuca sativa] gi|752834... 69 5e-10 >emb|CAD45096.2| ribosomal protein S2 [Amborella trichopoda] Length = 275 Score = 70.5 bits (171), Expect = 2e-10 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 26 KGEAVWGEMTRRYWNINIEEMMEAGVHIGHGTRKWNPK 139 K E VW EM RRYW+IN+EEMM AGVH GHGTRKWNP+ Sbjct: 32 KKEEVWVEMARRYWDINLEEMMGAGVHFGHGTRKWNPR 69 >gb|AEX99504.1| ribosomal protein S2 (chloroplast) [Chrysanthemum indicum] Length = 236 Score = 68.9 bits (167), Expect = 5e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 50 MTRRYWNINIEEMMEAGVHIGHGTRKWNPK 139 MTRRYWNIN+EEMMEAGVH GHGTRKWNPK Sbjct: 1 MTRRYWNINLEEMMEAGVHFGHGTRKWNPK 30 >ref|YP_007353756.1| ribosomal protein S2 (chloroplast) [Chrysanthemum x morifolium] gi|452849041|ref|YP_007474719.1| ribosomal protein S2 (chloroplast) [Chrysanthemum indicum] gi|372863196|gb|AEX99268.1| ribosomal protein S2 (chloroplast) [Chrysanthemum indicum] gi|375298825|gb|AFA45264.1| ribosomal protein S2 (chloroplast) [Chrysanthemum x morifolium] Length = 236 Score = 68.9 bits (167), Expect = 5e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 50 MTRRYWNINIEEMMEAGVHIGHGTRKWNPK 139 MTRRYWNIN+EEMMEAGVH GHGTRKWNPK Sbjct: 1 MTRRYWNINLEEMMEAGVHFGHGTRKWNPK 30 >ref|YP_398848.1| ribosomal protein S2 [Nicotiana tomentosiformis] gi|122245644|sp|Q33C49.1|RR2_NICTO RecName: Full=30S ribosomal protein S2, chloroplastic gi|80750910|dbj|BAE47986.1| ribosomal protein S2 [Nicotiana tomentosiformis] Length = 236 Score = 68.9 bits (167), Expect = 5e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 50 MTRRYWNINIEEMMEAGVHIGHGTRKWNPK 139 MTRRYWNIN+EEMMEAGVH GHGTRKWNPK Sbjct: 1 MTRRYWNINLEEMMEAGVHFGHGTRKWNPK 30 >ref|YP_398319.1| ribosomal protein S2 [Lactuca sativa] gi|75283447|sp|Q56P10.1|RR2_LACSA RecName: Full=30S ribosomal protein S2, chloroplastic gi|61992024|gb|AAX58145.1| ribosomal protein S2 [Lactuca sativa] gi|78675158|dbj|BAE47584.1| chloroplast 30S ribosomal protein S2 [Lactuca sativa] gi|88656973|gb|ABD47223.1| ribosomal protein S2 [Lactuca sativa] Length = 236 Score = 68.9 bits (167), Expect = 5e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 50 MTRRYWNINIEEMMEAGVHIGHGTRKWNPK 139 MTRRYWNIN+EEMMEAGVH GHGTRKWNPK Sbjct: 1 MTRRYWNINLEEMMEAGVHFGHGTRKWNPK 30