BLASTX nr result
ID: Atractylodes21_contig00025118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00025118 (214 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACJ04334.1| ubiquitin specific protease 12 [Nicotiana tabacum] 61 8e-08 ref|XP_002263912.2| PREDICTED: ubiquitin carboxyl-terminal hydro... 59 5e-07 ref|XP_002524120.1| Ubiquitin carboxyl-terminal hydrolase, putat... 59 5e-07 gb|ABA94399.1| Ubiquitin carboxyl-terminal hydrolase family prot... 58 7e-07 gb|EEE52311.1| hypothetical protein OsJ_34325 [Oryza sativa Japo... 58 7e-07 >gb|ACJ04334.1| ubiquitin specific protease 12 [Nicotiana tabacum] Length = 1116 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 109 MTLMTPPPVDPEEDEMLVPHSDLAATEGPQPMEVA 5 MT+MTPPPVDPEEDEMLVP+SD EGPQPMEVA Sbjct: 1 MTMMTPPPVDPEEDEMLVPNSDF-PVEGPQPMEVA 34 >ref|XP_002263912.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase 12-like [Vitis vinifera] gi|296084432|emb|CBI24991.3| unnamed protein product [Vitis vinifera] Length = 1115 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 109 MTLMTPPPVDPEEDEMLVPHSDLAATEGPQPMEVA 5 MTLMTPPP+D E+DEMLVPH+D A +GPQPMEVA Sbjct: 1 MTLMTPPPLDQEDDEMLVPHTDFA--DGPQPMEVA 33 >ref|XP_002524120.1| Ubiquitin carboxyl-terminal hydrolase, putative [Ricinus communis] gi|223536688|gb|EEF38330.1| Ubiquitin carboxyl-terminal hydrolase, putative [Ricinus communis] Length = 1120 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 109 MTLMTPPPVDPEEDEMLVPHSDLAATEGPQPMEVA 5 MT+MTPPP+D E++EMLVPHSDL EGPQPMEVA Sbjct: 1 MTMMTPPPLDQEDEEMLVPHSDL--VEGPQPMEVA 33 >gb|ABA94399.1| Ubiquitin carboxyl-terminal hydrolase family protein, expressed [Oryza sativa Japonica Group] Length = 1451 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -1 Query: 109 MTLMTPPPVDPEEDEMLVPHSDLAATEGPQPMEV 8 MT+MTPPP++PEEDEMLVPH +L A + QPMEV Sbjct: 1 MTMMTPPPLEPEEDEMLVPHQELVAADAAQPMEV 34 >gb|EEE52311.1| hypothetical protein OsJ_34325 [Oryza sativa Japonica Group] Length = 1142 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -1 Query: 109 MTLMTPPPVDPEEDEMLVPHSDLAATEGPQPMEV 8 MT+MTPPP++PEEDEMLVPH +L A + QPMEV Sbjct: 1 MTMMTPPPLEPEEDEMLVPHQELVAADAAQPMEV 34