BLASTX nr result
ID: Atractylodes21_contig00025114
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00025114 (271 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN08404.1| Retrotransposon gag protein [Medicago truncatula]... 55 5e-06 ref|XP_002532644.1| conserved hypothetical protein [Ricinus comm... 49 5e-06 >gb|ABN08404.1| Retrotransposon gag protein [Medicago truncatula] gi|124360393|gb|ABN08406.1| Retrotransposon gag protein [Medicago truncatula] Length = 224 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/56 (41%), Positives = 37/56 (66%) Frame = +2 Query: 71 IKELKMLVFDGDDAYGWIYWVERYYEIQDIRPEEKLRAATLCMEGKHYHGINGVVE 238 +K++++L+F+GDD GWI E Y+ +Q+ PE K+ A LCM+G H G++E Sbjct: 81 VKKVELLMFNGDDPAGWIARAEVYFNVQNTTPEIKVNLAQLCMDGPTIHFFKGLLE 136 >ref|XP_002532644.1| conserved hypothetical protein [Ricinus communis] gi|223527635|gb|EEF29747.1| conserved hypothetical protein [Ricinus communis] Length = 462 Score = 49.3 bits (116), Expect(3) = 5e-06 Identities = 19/44 (43%), Positives = 35/44 (79%) Frame = +2 Query: 74 KELKMLVFDGDDAYGWIYWVERYYEIQDIRPEEKLRAATLCMEG 205 ++LK+ VF+G++ GWI+ ERY++I +I ++L+AA++C+EG Sbjct: 106 RKLKLPVFEGENPDGWIFRAERYFDINNIPVVDRLKAASVCLEG 149 Score = 22.7 bits (47), Expect(3) = 5e-06 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +1 Query: 208 ALSWYQWSSGVR 243 AL+W+QW G R Sbjct: 151 ALAWFQWEEGRR 162 Score = 21.9 bits (45), Expect(3) = 5e-06 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 234 WSEGRNPFR 260 W EGR PFR Sbjct: 157 WEEGRRPFR 165