BLASTX nr result
ID: Atractylodes21_contig00025008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00025008 (1013 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN64561.1| hypothetical protein VITISV_038232 [Vitis vinifera] 74 6e-11 >emb|CAN64561.1| hypothetical protein VITISV_038232 [Vitis vinifera] Length = 140 Score = 73.9 bits (180), Expect = 6e-11 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 2/48 (4%) Frame = +3 Query: 753 MNDLGDLNFIS--SWESKPNSTALVLTQTKYTLDLLTRTHMQDSKPCP 890 M DLGD++FIS E+K ST+LVLTQTKYTLDLLTRTHMQDSKPCP Sbjct: 35 MKDLGDIHFISFLGIEAKRTSTSLVLTQTKYTLDLLTRTHMQDSKPCP 82