BLASTX nr result
ID: Atractylodes21_contig00024405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00024405 (520 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281939.1| PREDICTED: GDT1-like protein 4 [Vitis vinife... 58 9e-07 ref|XP_002312384.1| predicted membrane protein [Populus trichoca... 56 3e-06 ref|XP_002529148.1| Transmembrane protein TPARL, putative [Ricin... 56 3e-06 ref|XP_002314881.1| predicted membrane protein [Populus trichoca... 56 3e-06 gb|AFK33910.1| unknown [Lotus japonicus] 55 6e-06 >ref|XP_002281939.1| PREDICTED: GDT1-like protein 4 [Vitis vinifera] gi|297737851|emb|CBI27052.3| unnamed protein product [Vitis vinifera] Length = 230 Score = 57.8 bits (138), Expect = 9e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 518 SLATQISEKFIALSGGVLFIVFGIQSFFSTVES 420 SLA+QISEKF+ALSGGVLFIVFGIQS STVES Sbjct: 198 SLASQISEKFVALSGGVLFIVFGIQSLLSTVES 230 >ref|XP_002312384.1| predicted membrane protein [Populus trichocarpa] gi|222852204|gb|EEE89751.1| predicted membrane protein [Populus trichocarpa] Length = 224 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 518 SLATQISEKFIALSGGVLFIVFGIQSFFSTVE 423 SLA+QISEK +ALSGGVLFIVFGIQSF STVE Sbjct: 193 SLASQISEKIVALSGGVLFIVFGIQSFLSTVE 224 >ref|XP_002529148.1| Transmembrane protein TPARL, putative [Ricinus communis] gi|223531427|gb|EEF33261.1| Transmembrane protein TPARL, putative [Ricinus communis] Length = 228 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 518 SLATQISEKFIALSGGVLFIVFGIQSFFSTVE 423 SLA+QISEK +ALSGGVLFI+FGIQSF STVE Sbjct: 197 SLASQISEKIVALSGGVLFIIFGIQSFLSTVE 228 >ref|XP_002314881.1| predicted membrane protein [Populus trichocarpa] gi|222863921|gb|EEF01052.1| predicted membrane protein [Populus trichocarpa] Length = 228 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 518 SLATQISEKFIALSGGVLFIVFGIQSFFSTVE 423 SLA+QISEK +ALSGGVLFI+FGIQSF STVE Sbjct: 197 SLASQISEKIVALSGGVLFIIFGIQSFLSTVE 228 >gb|AFK33910.1| unknown [Lotus japonicus] Length = 229 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 518 SLATQISEKFIALSGGVLFIVFGIQSFFSTVES 420 SLA+QISEK +ALSGGVLFIVFGIQSF S VES Sbjct: 197 SLASQISEKVVALSGGVLFIVFGIQSFLSPVES 229