BLASTX nr result
ID: Atractylodes21_contig00024174
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00024174 (228 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271517.1| PREDICTED: uncharacterized protein LOC100265... 66 3e-09 ref|XP_002534434.1| conserved hypothetical protein [Ricinus comm... 64 1e-08 ref|XP_003537485.1| PREDICTED: uncharacterized protein LOC100801... 63 2e-08 ref|XP_003600879.1| Nuclear pore complex protein-related protein... 60 1e-07 ref|XP_002312155.1| predicted protein [Populus trichocarpa] gi|2... 59 5e-07 >ref|XP_002271517.1| PREDICTED: uncharacterized protein LOC100265724 [Vitis vinifera] gi|297736620|emb|CBI25491.3| unnamed protein product [Vitis vinifera] Length = 814 Score = 66.2 bits (160), Expect = 3e-09 Identities = 33/52 (63%), Positives = 43/52 (82%) Frame = -1 Query: 198 NQRRQIPGRKGNSEDDEISHLKSSIAKLSIVNSENTKKVKLVDSALRNREST 43 NQ+R I GRK ED +IS LKS+IAKLS+VNSEN K+VK+V+SAL+++E T Sbjct: 761 NQQRHISGRKNFVEDAQISQLKSAIAKLSLVNSENAKRVKVVESALKSQERT 812 >ref|XP_002534434.1| conserved hypothetical protein [Ricinus communis] gi|223525302|gb|EEF27949.1| conserved hypothetical protein [Ricinus communis] Length = 760 Score = 64.3 bits (155), Expect = 1e-08 Identities = 34/61 (55%), Positives = 49/61 (80%) Frame = -1 Query: 225 SSSPQSKRPNQRRQIPGRKGNSEDDEISHLKSSIAKLSIVNSENTKKVKLVDSALRNRES 46 + SP++K NQ+RQ+ G K D +IS LKSS+AKLS+VN+EN+KKVKLV+S L+++ES Sbjct: 700 TQSPRAKVLNQQRQMSG-KNYVRDVQISQLKSSLAKLSLVNNENSKKVKLVESVLKSQES 758 Query: 45 T 43 + Sbjct: 759 S 759 >ref|XP_003537485.1| PREDICTED: uncharacterized protein LOC100801853 [Glycine max] Length = 806 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/54 (53%), Positives = 46/54 (85%) Frame = -1 Query: 210 SKRPNQRRQIPGRKGNSEDDEISHLKSSIAKLSIVNSENTKKVKLVDSALRNRE 49 SK +Q+++ PG+K + DD++S LKSS+ KLS++N+EN+KKV+LV+S+LRN+E Sbjct: 742 SKANHQQQKTPGKKSYAGDDQMSLLKSSLEKLSLLNTENSKKVELVESSLRNKE 795 >ref|XP_003600879.1| Nuclear pore complex protein-related protein [Medicago truncatula] gi|355489927|gb|AES71130.1| Nuclear pore complex protein-related protein [Medicago truncatula] Length = 874 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/54 (55%), Positives = 43/54 (79%) Frame = -1 Query: 210 SKRPNQRRQIPGRKGNSEDDEISHLKSSIAKLSIVNSENTKKVKLVDSALRNRE 49 SK Q+++I G+K ++ DD+IS LKS++ KLSIVN EN+KKVK+V+S+L N E Sbjct: 807 SKASQQQKKISGKKISAGDDQISILKSALEKLSIVNIENSKKVKIVESSLNNTE 860 >ref|XP_002312155.1| predicted protein [Populus trichocarpa] gi|222851975|gb|EEE89522.1| predicted protein [Populus trichocarpa] Length = 642 Score = 58.5 bits (140), Expect = 5e-07 Identities = 32/52 (61%), Positives = 42/52 (80%) Frame = -1 Query: 198 NQRRQIPGRKGNSEDDEISHLKSSIAKLSIVNSENTKKVKLVDSALRNREST 43 NQ+ +I GR + D +I LKSSIAKLS++NSENTKKVKLV+S L+N+ES+ Sbjct: 591 NQQMKIGGRN-YALDAQILQLKSSIAKLSLLNSENTKKVKLVESVLKNQESS 641