BLASTX nr result
ID: Atractylodes21_contig00023943
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00023943 (403 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFH54536.1| GRAS family protein, partial [Dimocarpus longan] ... 66 3e-09 gb|ADK92865.1| phytochrome A signal transduction 1 [Hypericum pe... 65 6e-09 ref|XP_003544277.1| PREDICTED: scarecrow-like transcription fact... 64 2e-08 dbj|BAJ33619.1| unnamed protein product [Thellungiella halophila] 64 2e-08 ref|NP_199626.1| scarecrow-like transcription factor PAT1 [Arabi... 63 3e-08 >gb|AFH54536.1| GRAS family protein, partial [Dimocarpus longan] gi|448278878|gb|AGE44291.1| GRAS54 protein [Dimocarpus longan] Length = 552 Score = 65.9 bits (159), Expect = 3e-09 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 1 YCDKYRLEERDGALFLGWMNRDLVSSCAWK 90 YC+KYRL+ERDGAL+LGWMNRDLV+SCAWK Sbjct: 523 YCEKYRLQERDGALYLGWMNRDLVASCAWK 552 >gb|ADK92865.1| phytochrome A signal transduction 1 [Hypericum perforatum] Length = 538 Score = 65.1 bits (157), Expect = 6e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 1 YCDKYRLEERDGALFLGWMNRDLVSSCAWK 90 YC KYRLEERDG+L+LGWMNRDLV+SCAWK Sbjct: 509 YCSKYRLEERDGSLYLGWMNRDLVASCAWK 538 >ref|XP_003544277.1| PREDICTED: scarecrow-like transcription factor PAT1-like [Glycine max] Length = 545 Score = 63.5 bits (153), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 1 YCDKYRLEERDGALFLGWMNRDLVSSCAWK 90 Y D+YRLEERDGAL+LGWMNRDLV+SCAWK Sbjct: 516 YSDRYRLEERDGALYLGWMNRDLVASCAWK 545 >dbj|BAJ33619.1| unnamed protein product [Thellungiella halophila] Length = 502 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 1 YCDKYRLEERDGALFLGWMNRDLVSSCAWK 90 Y DKYRLEERDGALFLGWM RDLV+SCAWK Sbjct: 473 YSDKYRLEERDGALFLGWMQRDLVASCAWK 502 >ref|NP_199626.1| scarecrow-like transcription factor PAT1 [Arabidopsis thaliana] gi|42573614|ref|NP_974903.1| scarecrow-like transcription factor PAT1 [Arabidopsis thaliana] gi|75173838|sp|Q9LDL7.1|PAT1_ARATH RecName: Full=Scarecrow-like transcription factor PAT1; AltName: Full=GRAS family protein 29; Short=AtGRAS-29; AltName: Full=Protein PHYTOCHROME A SIGNAL TRANSDUCTION 1 gi|8132289|gb|AAF73237.1|AF153443_1 phytochrome A signal transduction 1 protein [Arabidopsis thaliana] gi|8777405|dbj|BAA96995.1| SCARECROW gene regulator-like [Arabidopsis thaliana] gi|95147294|gb|ABF57282.1| At5g48150 [Arabidopsis thaliana] gi|222423937|dbj|BAH19931.1| AT5G48150 [Arabidopsis thaliana] gi|222424904|dbj|BAH20403.1| AT5G48150 [Arabidopsis thaliana] gi|332008241|gb|AED95624.1| scarecrow-like transcription factor PAT1 [Arabidopsis thaliana] gi|332008242|gb|AED95625.1| scarecrow-like transcription factor PAT1 [Arabidopsis thaliana] Length = 490 Score = 62.8 bits (151), Expect = 3e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 1 YCDKYRLEERDGALFLGWMNRDLVSSCAWK 90 Y DKYRLEERDGAL+LGWM+RDLV+SCAWK Sbjct: 461 YSDKYRLEERDGALYLGWMHRDLVASCAWK 490