BLASTX nr result
ID: Atractylodes21_contig00023847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00023847 (380 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267812.1| PREDICTED: uncharacterized protein LOC100248... 52 1e-10 ref|XP_002519041.1| conserved hypothetical protein [Ricinus comm... 44 4e-08 ref|XP_003609258.1| hypothetical protein MTR_4g113740 [Medicago ... 41 4e-07 >ref|XP_002267812.1| PREDICTED: uncharacterized protein LOC100248155 [Vitis vinifera] Length = 780 Score = 51.6 bits (122), Expect(2) = 1e-10 Identities = 26/47 (55%), Positives = 30/47 (63%) Frame = -2 Query: 166 FVYLLGFVCALAXXXXXXXXXXVFPACFLVFAVGFSFGIVNGGDLND 26 FV+LLG VCALA VFPA VFAVGFSFG+V GG ++ Sbjct: 104 FVFLLGLVCALAISRVRVSSILVFPASVFVFAVGFSFGLVRGGSASE 150 Score = 39.3 bits (90), Expect(2) = 1e-10 Identities = 20/37 (54%), Positives = 23/37 (62%), Gaps = 3/37 (8%) Frame = -3 Query: 324 DYGGWADLSSVG---DSGESNQLSRLLSSLGIDDKKY 223 +YGGW D G SGESNQ L S+GIDD+KY Sbjct: 66 NYGGWDDPRLGGGSDQSGESNQFRNFLVSVGIDDRKY 102 >ref|XP_002519041.1| conserved hypothetical protein [Ricinus communis] gi|223541704|gb|EEF43252.1| conserved hypothetical protein [Ricinus communis] Length = 754 Score = 43.5 bits (101), Expect(2) = 4e-08 Identities = 21/45 (46%), Positives = 25/45 (55%) Frame = -2 Query: 166 FVYLLGFVCALAXXXXXXXXXXVFPACFLVFAVGFSFGIVNGGDL 32 FV+ LG CA A VFPA L+FA+GFS G GG+L Sbjct: 105 FVFFLGIFCAFAISRVRVSSIIVFPASVLIFAIGFSLGFFRGGNL 149 Score = 38.5 bits (88), Expect(2) = 4e-08 Identities = 25/54 (46%), Positives = 29/54 (53%), Gaps = 4/54 (7%) Frame = -3 Query: 375 TKPLPRYKIT-TLCSYSADYGGWADLSSVGD---SGESNQLSRLLSSLGIDDKK 226 TK P K + T S +YGGW D GD SGES+Q+ L S GIDD K Sbjct: 48 TKTFPVIKASATTNDNSLNYGGWDDFRLGGDLPNSGESSQVPYFLVSRGIDDSK 101 >ref|XP_003609258.1| hypothetical protein MTR_4g113740 [Medicago truncatula] gi|355510313|gb|AES91455.1| hypothetical protein MTR_4g113740 [Medicago truncatula] Length = 734 Score = 40.8 bits (94), Expect(2) = 4e-07 Identities = 21/42 (50%), Positives = 26/42 (61%) Frame = -3 Query: 345 TLCSYSADYGGWADLSSVGDSGESNQLSRLLSSLGIDDKKYA 220 T S S YGGW +L+S SGE + L L S+GIDD+K A Sbjct: 50 TSASTSTVYGGWDELASSEASGEFDSLRNFLVSVGIDDRKNA 91 Score = 38.1 bits (87), Expect(2) = 4e-07 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = -2 Query: 166 FVYLLGFVCALAXXXXXXXXXXVFPACFLVFAVGFSFGIVNGGDLN 29 FV+ LG VCA+A + PA +VFA+G+S G + G+ + Sbjct: 92 FVFFLGIVCAMAISRVRVSTVLILPASAMVFALGYSVGFLRNGNFS 137