BLASTX nr result
ID: Atractylodes21_contig00023547
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00023547 (911 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75314.1| hypothetical protein VITISV_028740 [Vitis vinifera] 50 3e-11 ref|XP_002271878.2| PREDICTED: uracil-DNA glycosylase [Vitis vin... 49 7e-11 emb|CBI27448.3| unnamed protein product [Vitis vinifera] 49 7e-11 ref|XP_002521497.1| uracil DNA glycosylase, putative [Ricinus co... 48 2e-10 ref|NP_188493.1| uracil dna glycosylase [Arabidopsis thaliana] g... 48 7e-10 >emb|CAN75314.1| hypothetical protein VITISV_028740 [Vitis vinifera] Length = 281 Score = 50.1 bits (118), Expect(2) = 3e-11 Identities = 24/38 (63%), Positives = 28/38 (73%) Frame = -3 Query: 543 EGWDFLKLEELLVEETWLKPLAGEFQYPCAKKLSEFIE 430 EG F++LE+LLVEETWL L GEFQ P AK L F+E Sbjct: 88 EGVGFVELEDLLVEETWLDALPGEFQKPYAKTLCRFLE 125 Score = 44.7 bits (104), Expect(2) = 3e-11 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -1 Query: 410 P*HLIFNARNSTPLDKVKAIIIGQD 336 P HLIFNA NSTP D+VKA+IIGQD Sbjct: 138 PQHLIFNALNSTPFDRVKAVIIGQD 162 >ref|XP_002271878.2| PREDICTED: uracil-DNA glycosylase [Vitis vinifera] Length = 328 Score = 48.9 bits (115), Expect(2) = 7e-11 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = -3 Query: 543 EGWDFLKLEELLVEETWLKPLAGEFQYPCAKKLSEFIE 430 EG F++LE+LL+EETWL L GEFQ P AK L F+E Sbjct: 97 EGVGFVELEDLLLEETWLDALPGEFQKPYAKTLCRFLE 134 Score = 44.7 bits (104), Expect(2) = 7e-11 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -1 Query: 410 P*HLIFNARNSTPLDKVKAIIIGQD 336 P HLIFNA NSTP D+VKA+IIGQD Sbjct: 147 PQHLIFNALNSTPFDRVKAVIIGQD 171 >emb|CBI27448.3| unnamed protein product [Vitis vinifera] Length = 321 Score = 48.9 bits (115), Expect(2) = 7e-11 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = -3 Query: 543 EGWDFLKLEELLVEETWLKPLAGEFQYPCAKKLSEFIE 430 EG F++LE+LL+EETWL L GEFQ P AK L F+E Sbjct: 90 EGVGFVELEDLLLEETWLDALPGEFQKPYAKTLCRFLE 127 Score = 44.7 bits (104), Expect(2) = 7e-11 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -1 Query: 410 P*HLIFNARNSTPLDKVKAIIIGQD 336 P HLIFNA NSTP D+VKA+IIGQD Sbjct: 140 PQHLIFNALNSTPFDRVKAVIIGQD 164 >ref|XP_002521497.1| uracil DNA glycosylase, putative [Ricinus communis] gi|223539294|gb|EEF40886.1| uracil DNA glycosylase, putative [Ricinus communis] Length = 332 Score = 47.8 bits (112), Expect(2) = 2e-10 Identities = 28/56 (50%), Positives = 33/56 (58%), Gaps = 3/56 (5%) Frame = -3 Query: 588 NLNHL*Y**NPICL---GEGWDFLKLEELLVEETWLKPLAGEFQYPCAKKLSEFIE 430 NLNH CL ++KLEELLVEETW++ L GE Q P AK L +FIE Sbjct: 63 NLNH--------CLQLVSNSKSYVKLEELLVEETWVEALPGELQKPYAKTLCKFIE 110 Score = 44.3 bits (103), Expect(2) = 2e-10 Identities = 19/25 (76%), Positives = 22/25 (88%) Frame = -1 Query: 410 P*HLIFNARNSTPLDKVKAIIIGQD 336 P HLIFNA NSTP D++KA+IIGQD Sbjct: 123 PQHLIFNALNSTPFDRIKAVIIGQD 147 >ref|NP_188493.1| uracil dna glycosylase [Arabidopsis thaliana] gi|9294324|dbj|BAB02221.1| uracil-DNA glycosylase-like protein [Arabidopsis thaliana] gi|21537176|gb|AAM61517.1| uracil-DNA glycosylase, putative [Arabidopsis thaliana] gi|115646763|gb|ABJ17110.1| At3g18630 [Arabidopsis thaliana] gi|332642603|gb|AEE76124.1| uracil dna glycosylase [Arabidopsis thaliana] Length = 330 Score = 48.1 bits (113), Expect(2) = 7e-10 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = -3 Query: 543 EGWDFLKLEELLVEETWLKPLAGEFQYPCAKKLSEFIE 430 EG ++ L ELLVEE+WLK L GEF P AK LS+F+E Sbjct: 97 EGNCYVPLSELLVEESWLKALPGEFHKPYAKSLSDFLE 134 Score = 42.0 bits (97), Expect(2) = 7e-10 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -1 Query: 410 P*HLIFNARNSTPLDKVKAIIIGQD 336 P HLIFNA N+TP D+VK +IIGQD Sbjct: 149 PQHLIFNALNTTPFDRVKTVIIGQD 173