BLASTX nr result
ID: Atractylodes21_contig00023457
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00023457 (420 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003593522.1| Allantoinase [Medicago truncatula] gi|124360... 82 3e-14 ref|XP_003593519.1| Allantoinase [Medicago truncatula] gi|355482... 81 1e-13 ref|XP_002305806.1| predicted protein [Populus trichocarpa] gi|2... 80 1e-13 gb|AAR29343.1| allantoinase [Robinia pseudoacacia] 79 3e-13 ref|XP_003543054.1| PREDICTED: probable allantoinase 1-like [Gly... 79 5e-13 >ref|XP_003593522.1| Allantoinase [Medicago truncatula] gi|124360607|gb|ABN08606.1| Dihydroorotase [Medicago truncatula] gi|355482570|gb|AES63773.1| Allantoinase [Medicago truncatula] Length = 504 Score = 82.4 bits (202), Expect = 3e-14 Identities = 39/48 (81%), Positives = 41/48 (85%) Frame = -2 Query: 419 PVHLKHPSISAYMGSRLAGKVLATFVNGNLVFDDGKHAPDACGTTILA 276 PV +KHPS+SAYMGSRLAGKVL TFV GNLVF DGKHAP ACG ILA Sbjct: 456 PVFIKHPSLSAYMGSRLAGKVLDTFVRGNLVFKDGKHAPAACGVPILA 503 >ref|XP_003593519.1| Allantoinase [Medicago truncatula] gi|355482567|gb|AES63770.1| Allantoinase [Medicago truncatula] Length = 652 Score = 80.9 bits (198), Expect = 1e-13 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = -2 Query: 419 PVHLKHPSISAYMGSRLAGKVLATFVNGNLVFDDGKHAPDACGTTIL 279 PV +KHPS+SAYMGSRLAGKVL TFV GNLVF DGKHAP ACG IL Sbjct: 588 PVFIKHPSLSAYMGSRLAGKVLDTFVRGNLVFKDGKHAPAACGVPIL 634 >ref|XP_002305806.1| predicted protein [Populus trichocarpa] gi|222848770|gb|EEE86317.1| predicted protein [Populus trichocarpa] Length = 504 Score = 80.5 bits (197), Expect = 1e-13 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = -2 Query: 419 PVHLKHPSISAYMGSRLAGKVLATFVNGNLVFDDGKHAPDACGTTILA 276 PV+LKHPSISAYMGS+L+GKV++TFV GNLV+ +GKHAP ACG ILA Sbjct: 456 PVYLKHPSISAYMGSKLSGKVMSTFVRGNLVYKEGKHAPAACGAPILA 503 >gb|AAR29343.1| allantoinase [Robinia pseudoacacia] Length = 512 Score = 79.3 bits (194), Expect = 3e-13 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = -2 Query: 419 PVHLKHPSISAYMGSRLAGKVLATFVNGNLVFDDGKHAPDACGTTILA 276 PV +KHPS+SAYMG RL+GKVL TFV GNLVF DGKHAP ACG ILA Sbjct: 464 PVFIKHPSLSAYMGRRLSGKVLDTFVRGNLVFKDGKHAPAACGVPILA 511 >ref|XP_003543054.1| PREDICTED: probable allantoinase 1-like [Glycine max] Length = 512 Score = 78.6 bits (192), Expect = 5e-13 Identities = 37/48 (77%), Positives = 39/48 (81%) Frame = -2 Query: 419 PVHLKHPSISAYMGSRLAGKVLATFVNGNLVFDDGKHAPDACGTTILA 276 PV LKHPS+SAYMG RL+GKVL TFV GNLVF GKHAP ACG ILA Sbjct: 464 PVFLKHPSLSAYMGRRLSGKVLETFVRGNLVFKKGKHAPSACGVPILA 511