BLASTX nr result
ID: Atractylodes21_contig00023454
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00023454 (248 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278267.1| PREDICTED: pre-mRNA-splicing factor 18-like ... 87 2e-15 ref|XP_002892149.1| splicing factor Prp18 family protein [Arabid... 86 4e-15 ref|NP_563676.1| splicing factor Prp18-like protein [Arabidopsis... 84 9e-15 ref|XP_002307588.1| predicted protein [Populus trichocarpa] gi|2... 84 9e-15 ref|XP_002520726.1| potassium channel regulatory factor, putativ... 83 3e-14 >ref|XP_002278267.1| PREDICTED: pre-mRNA-splicing factor 18-like [Vitis vinifera] Length = 412 Score = 86.7 bits (213), Expect = 2e-15 Identities = 42/52 (80%), Positives = 49/52 (94%) Frame = -2 Query: 247 RLDRLKYILKAGLFELDDSDMTEGQTNDFLRDTVDLKKRQKSGILSDRKRKA 92 RLDRLKY+LKAG+FE+D SDMTEGQTNDFLRD +L+KRQK+GILSDRKRK+ Sbjct: 125 RLDRLKYVLKAGIFEVD-SDMTEGQTNDFLRDIAELRKRQKTGILSDRKRKS 175 >ref|XP_002892149.1| splicing factor Prp18 family protein [Arabidopsis lyrata subsp. lyrata] gi|297337991|gb|EFH68408.1| splicing factor Prp18 family protein [Arabidopsis lyrata subsp. lyrata] Length = 417 Score = 85.5 bits (210), Expect = 4e-15 Identities = 42/52 (80%), Positives = 47/52 (90%) Frame = -2 Query: 247 RLDRLKYILKAGLFELDDSDMTEGQTNDFLRDTVDLKKRQKSGILSDRKRKA 92 RLDRLKY+LK GLFE+D SDMTEGQTNDFLRD +LKKRQKSGI+ DRKRK+ Sbjct: 127 RLDRLKYVLKEGLFEVD-SDMTEGQTNDFLRDIAELKKRQKSGIMGDRKRKS 177 >ref|NP_563676.1| splicing factor Prp18-like protein [Arabidopsis thaliana] gi|4587563|gb|AAD25794.1|AC006550_2 Similar to gb|U51990 pre-mRNA-splicing factor hPrp18 from Homo sapiens. ESTs gb|T46391 and gb|AA721815 come from this gene [Arabidopsis thaliana] gi|13430636|gb|AAK25940.1|AF360230_1 unknown protein [Arabidopsis thaliana] gi|15293173|gb|AAK93697.1| unknown protein [Arabidopsis thaliana] gi|332189414|gb|AEE27535.1| splicing factor Prp18-like protein [Arabidopsis thaliana] Length = 420 Score = 84.3 bits (207), Expect = 9e-15 Identities = 41/52 (78%), Positives = 47/52 (90%) Frame = -2 Query: 247 RLDRLKYILKAGLFELDDSDMTEGQTNDFLRDTVDLKKRQKSGILSDRKRKA 92 RLDRLKY+LK GLFE+D SDMTEGQTNDFLRD +LKKRQKSG++ DRKRK+ Sbjct: 130 RLDRLKYVLKEGLFEVD-SDMTEGQTNDFLRDIAELKKRQKSGMMGDRKRKS 180 >ref|XP_002307588.1| predicted protein [Populus trichocarpa] gi|222857037|gb|EEE94584.1| predicted protein [Populus trichocarpa] Length = 420 Score = 84.3 bits (207), Expect = 9e-15 Identities = 42/51 (82%), Positives = 47/51 (92%) Frame = -2 Query: 247 RLDRLKYILKAGLFELDDSDMTEGQTNDFLRDTVDLKKRQKSGILSDRKRK 95 RLDRLKY+LKAGLFE+D SDMTEGQTNDFLRD +L+KRQKSGI+S RKRK Sbjct: 132 RLDRLKYVLKAGLFEVD-SDMTEGQTNDFLRDIAELRKRQKSGIVSGRKRK 181 >ref|XP_002520726.1| potassium channel regulatory factor, putative [Ricinus communis] gi|223540111|gb|EEF41688.1| potassium channel regulatory factor, putative [Ricinus communis] Length = 417 Score = 82.8 bits (203), Expect = 3e-14 Identities = 40/51 (78%), Positives = 48/51 (94%) Frame = -2 Query: 247 RLDRLKYILKAGLFELDDSDMTEGQTNDFLRDTVDLKKRQKSGILSDRKRK 95 RLDRLK++LKAG+FE+D SDMTEGQTNDFLRD +L+KRQKSGI+S+RKRK Sbjct: 128 RLDRLKHVLKAGIFEVD-SDMTEGQTNDFLRDIAELRKRQKSGIVSERKRK 177