BLASTX nr result
ID: Atractylodes21_contig00023141
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00023141 (352 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001152053.1| ORF47a [Pinus koraiensis] gi|145048680|gb|AA... 62 5e-08 >ref|YP_001152053.1| ORF47a [Pinus koraiensis] gi|145048680|gb|AAO73984.2| ORF47a [Pinus koraiensis] Length = 47 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/42 (69%), Positives = 33/42 (78%), Gaps = 3/42 (7%) Frame = -3 Query: 263 GKAVCNEKCKHGLGRDFYL---FNKEIIYSIRLVPGSNPGQP 147 GKAVCNE CKHGLGRDF L ++II+SIR PGS+PGQP Sbjct: 2 GKAVCNENCKHGLGRDFSLLLILKEQIIHSIRRAPGSSPGQP 43