BLASTX nr result
ID: Atractylodes21_contig00023013
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00023013 (514 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC87835.1| cullin 1A [Nicotiana tabacum] 61 1e-07 emb|CAC87836.1| cullin 1B [Nicotiana tabacum] 61 1e-07 gb|ACS69068.1| CULLIN1-like protein 1 [Lilium longiflorum] 61 1e-07 ref|XP_003568931.1| PREDICTED: cullin-1-like isoform 2 [Brachypo... 60 2e-07 ref|XP_003568930.1| PREDICTED: cullin-1-like isoform 1 [Brachypo... 60 2e-07 >emb|CAC87835.1| cullin 1A [Nicotiana tabacum] Length = 741 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/34 (73%), Positives = 33/34 (97%) Frame = +1 Query: 43 QPDFKAIKRSVEDLITREYMERDRENPDLYKYLA 144 +PDFKAIK+ +EDLITR+Y+ERD+ENP+L+KYLA Sbjct: 708 KPDFKAIKKRIEDLITRDYLERDKENPNLFKYLA 741 >emb|CAC87836.1| cullin 1B [Nicotiana tabacum] Length = 739 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/34 (73%), Positives = 33/34 (97%) Frame = +1 Query: 43 QPDFKAIKRSVEDLITREYMERDRENPDLYKYLA 144 +PDFKAIK+ +EDLITR+Y+ERD+ENP+L+KYLA Sbjct: 706 KPDFKAIKKRIEDLITRDYLERDKENPNLFKYLA 739 >gb|ACS69068.1| CULLIN1-like protein 1 [Lilium longiflorum] Length = 744 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/34 (73%), Positives = 33/34 (97%) Frame = +1 Query: 43 QPDFKAIKRSVEDLITREYMERDRENPDLYKYLA 144 +PDFKAIK+ +EDLI+REY+ERD++NP+LYKYLA Sbjct: 711 KPDFKAIKKRIEDLISREYLERDKDNPNLYKYLA 744 >ref|XP_003568931.1| PREDICTED: cullin-1-like isoform 2 [Brachypodium distachyon] Length = 750 Score = 60.1 bits (144), Expect = 2e-07 Identities = 24/34 (70%), Positives = 33/34 (97%) Frame = +1 Query: 43 QPDFKAIKRSVEDLITREYMERDRENPDLYKYLA 144 +PDFKAIK+ +EDLITR+Y+ERD+ENP++Y+YLA Sbjct: 717 KPDFKAIKKRIEDLITRDYLERDKENPNVYRYLA 750 >ref|XP_003568930.1| PREDICTED: cullin-1-like isoform 1 [Brachypodium distachyon] Length = 744 Score = 60.1 bits (144), Expect = 2e-07 Identities = 24/34 (70%), Positives = 33/34 (97%) Frame = +1 Query: 43 QPDFKAIKRSVEDLITREYMERDRENPDLYKYLA 144 +PDFKAIK+ +EDLITR+Y+ERD+ENP++Y+YLA Sbjct: 711 KPDFKAIKKRIEDLITRDYLERDKENPNVYRYLA 744