BLASTX nr result
ID: Atractylodes21_contig00022992
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00022992 (358 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001240134.1| uncharacterized protein LOC100809053 [Glycin... 80 2e-13 ref|XP_003520282.1| PREDICTED: epoxide hydrolase 2-like [Glycine... 80 2e-13 ref|XP_002310826.1| predicted protein [Populus trichocarpa] gi|2... 79 3e-13 ref|XP_002521508.1| epoxide hydrolase, putative [Ricinus communi... 79 4e-13 gb|AFK43554.1| unknown [Lotus japonicus] 77 1e-12 >ref|NP_001240134.1| uncharacterized protein LOC100809053 [Glycine max] gi|255647918|gb|ACU24417.1| unknown [Glycine max] Length = 327 Score = 80.1 bits (196), Expect = 2e-13 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +2 Query: 236 RIKTNGIWMHVAEKGQGSLVLLLHGFPETWFSWRHQITHLA 358 RIKTNGIW+HVAEKG G LVLLLHGFPETW++WRHQI LA Sbjct: 14 RIKTNGIWLHVAEKGTGPLVLLLHGFPETWYAWRHQINFLA 54 >ref|XP_003520282.1| PREDICTED: epoxide hydrolase 2-like [Glycine max] Length = 327 Score = 79.7 bits (195), Expect = 2e-13 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +2 Query: 236 RIKTNGIWMHVAEKGQGSLVLLLHGFPETWFSWRHQITHLA 358 RIKTNGIW+HVAEKG G LVLLLHGFPETW++WRHQI LA Sbjct: 14 RIKTNGIWIHVAEKGTGPLVLLLHGFPETWYAWRHQINFLA 54 >ref|XP_002310826.1| predicted protein [Populus trichocarpa] gi|222853729|gb|EEE91276.1| predicted protein [Populus trichocarpa] Length = 321 Score = 79.3 bits (194), Expect = 3e-13 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +2 Query: 236 RIKTNGIWMHVAEKGQGSLVLLLHGFPETWFSWRHQITHLA 358 RIKTNGIW+HV EKG G LVLLLHGFPE W+SWRHQIT LA Sbjct: 10 RIKTNGIWLHVVEKGSGPLVLLLHGFPEFWYSWRHQITFLA 50 >ref|XP_002521508.1| epoxide hydrolase, putative [Ricinus communis] gi|223539186|gb|EEF40779.1| epoxide hydrolase, putative [Ricinus communis] Length = 319 Score = 79.0 bits (193), Expect = 4e-13 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +2 Query: 236 RIKTNGIWMHVAEKGQGSLVLLLHGFPETWFSWRHQITHLA 358 RIKTNGIW+H+AEKG G LVLLLHGFPE W+SWRHQI+ LA Sbjct: 8 RIKTNGIWLHIAEKGTGPLVLLLHGFPELWYSWRHQISFLA 48 >gb|AFK43554.1| unknown [Lotus japonicus] Length = 320 Score = 77.4 bits (189), Expect = 1e-12 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = +2 Query: 236 RIKTNGIWMHVAEKGQGSLVLLLHGFPETWFSWRHQITHLA 358 RIKTNGIW+HVAE+G G LVLLLHGFPE W+SWRHQ+ +LA Sbjct: 11 RIKTNGIWIHVAEQGTGPLVLLLHGFPEIWYSWRHQLNYLA 51