BLASTX nr result
ID: Atractylodes21_contig00022976
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00022976 (595 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317301.1| outward rectifying potassium channel [Populu... 96 6e-18 ref|XP_002519734.1| Calcium-activated outward-rectifying potassi... 92 7e-17 ref|XP_002331863.1| outward rectifying potassium channel [Populu... 92 7e-17 emb|CBI30826.3| unnamed protein product [Vitis vinifera] 91 1e-16 ref|XP_002272049.1| PREDICTED: probable calcium-activated outwar... 91 1e-16 >ref|XP_002317301.1| outward rectifying potassium channel [Populus trichocarpa] gi|222860366|gb|EEE97913.1| outward rectifying potassium channel [Populus trichocarpa] Length = 428 Score = 95.5 bits (236), Expect = 6e-18 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = +3 Query: 3 DNNGYVSKSEFVIYKLKEMGKISEKDILQICKIFDRLDTGNCGKIMLADLM 155 DNNG+VSKSE+VIYKLKEMGKISEKDILQIC+ F+RLDTGNCGKI LADLM Sbjct: 374 DNNGFVSKSEYVIYKLKEMGKISEKDILQICQQFERLDTGNCGKITLADLM 424 >ref|XP_002519734.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] gi|223541151|gb|EEF42707.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] Length = 426 Score = 92.0 bits (227), Expect = 7e-17 Identities = 41/51 (80%), Positives = 47/51 (92%) Frame = +3 Query: 3 DNNGYVSKSEFVIYKLKEMGKISEKDILQICKIFDRLDTGNCGKIMLADLM 155 D NG+VSKSE+VIYKLKEMGK+SEKD+LQIC+ FDR+D GNCGKI LADLM Sbjct: 372 DQNGFVSKSEYVIYKLKEMGKVSEKDVLQICQTFDRIDAGNCGKITLADLM 422 >ref|XP_002331863.1| outward rectifying potassium channel [Populus trichocarpa] gi|222875381|gb|EEF12512.1| outward rectifying potassium channel [Populus trichocarpa] Length = 435 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = +3 Query: 3 DNNGYVSKSEFVIYKLKEMGKISEKDILQICKIFDRLDTGNCGKIMLADLM 155 DNNG+VSKSE+ IYKLKEM K+SEKDILQIC+ FDRLDTGNCGKI LADLM Sbjct: 381 DNNGFVSKSEYAIYKLKEMEKVSEKDILQICQQFDRLDTGNCGKITLADLM 431 >emb|CBI30826.3| unnamed protein product [Vitis vinifera] Length = 312 Score = 91.3 bits (225), Expect = 1e-16 Identities = 42/51 (82%), Positives = 47/51 (92%) Frame = +3 Query: 3 DNNGYVSKSEFVIYKLKEMGKISEKDILQICKIFDRLDTGNCGKIMLADLM 155 DNNG+VSKSE+VIYKLKE+GK+SEKDI QIC FDRLD+GNCGKI LADLM Sbjct: 258 DNNGFVSKSEYVIYKLKELGKVSEKDISQICNKFDRLDSGNCGKITLADLM 308 >ref|XP_002272049.1| PREDICTED: probable calcium-activated outward-rectifying potassium channel 6-like [Vitis vinifera] Length = 509 Score = 91.3 bits (225), Expect = 1e-16 Identities = 42/51 (82%), Positives = 47/51 (92%) Frame = +3 Query: 3 DNNGYVSKSEFVIYKLKEMGKISEKDILQICKIFDRLDTGNCGKIMLADLM 155 DNNG+VSKSE+VIYKLKE+GK+SEKDI QIC FDRLD+GNCGKI LADLM Sbjct: 455 DNNGFVSKSEYVIYKLKELGKVSEKDISQICNKFDRLDSGNCGKITLADLM 505