BLASTX nr result
ID: Atractylodes21_contig00022948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00022948 (391 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635480.1| PREDICTED: uncharacterized protein LOC100853... 63 2e-08 ref|XP_002525028.1| conserved hypothetical protein [Ricinus comm... 63 3e-08 ref|XP_002525029.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 >ref|XP_003635480.1| PREDICTED: uncharacterized protein LOC100853147 [Vitis vinifera] gi|296090665|emb|CBI41065.3| unnamed protein product [Vitis vinifera] Length = 68 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/61 (47%), Positives = 38/61 (62%), Gaps = 3/61 (4%) Frame = +1 Query: 64 LARLLVWFLAVASLVIWSHAA---AAGDSSIHPQAGCRCCNFVYVKGLITCGRVCCQDGC 234 L L W L VA +V ++ A A + +HPQAGCRCC F++ K I+CG+ CC DGC Sbjct: 6 LVTALAWLLVVAFVVTYATATDHFQAVEDMVHPQAGCRCCWFIW-KPRISCGKACCGDGC 64 Query: 235 C 237 C Sbjct: 65 C 65 >ref|XP_002525028.1| conserved hypothetical protein [Ricinus communis] gi|223535690|gb|EEF37355.1| conserved hypothetical protein [Ricinus communis] Length = 72 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/59 (47%), Positives = 35/59 (59%), Gaps = 5/59 (8%) Frame = +1 Query: 76 LVWFLAVASLVIWSHAAAA-----GDSSIHPQAGCRCCNFVYVKGLITCGRVCCQDGCC 237 L WFL V S+ I ++A A + + PQAGCRCC F+ I CG VCC+DGCC Sbjct: 11 LTWFLVVMSIAICANATAGPRLQTSEHMVQPQAGCRCCFFIGRIPNIRCGNVCCEDGCC 69 >ref|XP_002525029.1| conserved hypothetical protein [Ricinus communis] gi|223535691|gb|EEF37356.1| conserved hypothetical protein [Ricinus communis] Length = 70 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/59 (47%), Positives = 34/59 (57%), Gaps = 5/59 (8%) Frame = +1 Query: 76 LVWFLAVASLVIWSHAAA-----AGDSSIHPQAGCRCCNFVYVKGLITCGRVCCQDGCC 237 L WFL V S+ I ++A A A D + AGCRCC F+ + CG VCCQDGCC Sbjct: 11 LTWFLVVMSVAICANATAGPRLQASDEHMELPAGCRCCYFIGQIPYMRCGMVCCQDGCC 69